(data stored in ACNUC9435 zone)

EMBL: AM039951.PE118

AM039951.PE118       Location/Qualifiers
FT   CDS_pept        129663..130436
FT                   /transl_table=11
FT                   /locus_tag="XCVd0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19930.1"
FT                   /translation="MVILCAQQNPKPHHQTRRNDREHDAMTHNEAITAPETSPQLVSIP
FT                   PQVIQAAAIASAGGAAEWNLLSARAQQEAHADCEVIIRTAVSALRQAGVASDGSDASTI
FT                   TTIRRLRAALELIATQGPHFGHDGTQETWMHWADIARKALTDQAAGYKHLSPQPDQIPT
FT                   ISQQREPSYWTETLLASAEKLRVRIGGQPDGDADDLERLAAAIRAPNGYIVKVGGAAYR
FT                   YDLCASTAAYAREAALATGLEPEDFTVEPFLVIHP"
     gtggtcatac tatgcgcgca acaaaatcct aagcctcatc accaaacacg gcggaacgac        60
     cgggagcacg acgcgatgac ccataatgag gccattacgg cgccagagac atcaccgcag       120
     ctggtgagca tcccgcccca ggtaattcag gctgcagcga tcgcatccgc cggcggcgca       180
     gcagagtgga acctactgag cgccagagct caacaagaag cacatgccga ctgcgaggtg       240
     atcatccgca ccgccgtcag cgcactgcgg caagcaggtg tggcatcgga tggaagcgat       300
     gcgtctacga tcacgaccat ccgcagactc cgcgctgcat tggagttgat tgctacgcaa       360
     gggccgcact tcggtcacga tggcacgcaa gaaacatgga tgcattgggc agatattgcc       420
     cgaaaagcac tgaccgatca ggctgccggt tacaaacacc tatccccgca gcccgaccaa       480
     ataccaacca tctctcaaca acgagaaccc tcatactgga ccgagacctt gctagcaagc       540
     gcggagaaac tgcgtgtccg cattggtgga cagccggatg gcgatgccga tgatctggag       600
     cggctagctg cagcgatccg cgcgccgaat ggctacatcg tgaaggttgg gggtgcggcc       660
     tatcgctacg acctgtgcgc ttctaccgcc gcctacgccc gtgaggctgc tctggcaacg       720
     gggctggaac cggaagattt taccgtcgag ccattcctgg tgatccaccc atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page