(data stored in ACNUC9435 zone)

EMBL: AM039951.PE119

AM039951.PE119       Location/Qualifiers
FT   CDS_pept        130456..130926
FT                   /transl_table=11
FT                   /locus_tag="XCVd0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19931"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19931.1"
FT                   /translation="MTPTSSRIQRVRQAGSEHQVVTVQSPKQASARYCKRPCPDCPWRV
FT                   DAVGKWPAEAFRASAETAYDMATHTFACHSAGATNPRLCAGFLLRGADHNLSVRLERMH
FT                   GRVGSDVEDGGQILYPSYVAMAVANGVPSNDPALQACRESYFEAQQVDSGEQ"
     atgaccccca cctccagcag gatccaacgc gttcgccagg ccggcagcga gcatcaggtg        60
     gtaacggtcc aaagcccaaa acaggccagt gcacgctact gcaagcgccc atgccctgat       120
     tgcccctggc gggtcgacgc ggtaggcaag tggccagcag aagcgtttcg tgcatctgct       180
     gagacggcgt atgacatggc aacgcacacg ttcgcgtgcc actctgccgg cgccaccaac       240
     ccgcggctat gcgcagggtt ccttctgcga ggcgcagacc ataacttgag cgtccgcctt       300
     gagcgcatgc acggtcgtgt gggcagcgat gtcgaagacg gcgggcagat cctttaccca       360
     tcctacgtcg ccatggccgt cgccaatggg gtaccgagca atgatccagc actacaggca       420
     tgccgcgaaa gctacttcga ggcacagcaa gttgattcgg gtgaacaatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page