(data stored in ACNUC9435 zone)

EMBL: AM039951.PE121

AM039951.PE121       Location/Qualifiers
FT   CDS_pept        131923..132363
FT                   /transl_table=11
FT                   /locus_tag="XCVd0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19933"
FT                   /db_xref="InterPro:IPR021686"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19933.1"
FT                   /translation="MHSEFDPWHPSSAAIARVKNALTAPTRHDCGGIVEIRSHREVFGR
FT                   NYGNWPWVYFCTHCRARVGMHPFTDIPLGTLADEPTRNARTAAKTLFEQLWRRADSPLS
FT                   RSAAYAWLANQLSLPMSACHFGLFDIATCERARLACRQYLEP"
     gtgcactctg agtttgaccc ttggcaccct agctccgcgg caatagcgcg ggtgaaaaac        60
     gccctaaccg cgccaacgcg ccacgattgc ggcggcatcg tggagatccg cagccatcgc       120
     gaagtctttg ggcgcaacta cggcaattgg ccatgggtct atttctgcac gcactgccgg       180
     gcccgcgttg ggatgcaccc gttcaccgac atcccgctcg gcacgctggc cgatgagccg       240
     acacgcaatg cgcgcacggc agcgaaaacg ctgttcgagc agctctggag gcgtgccgac       300
     agtccactga gtcggtctgc ggcttatgcc tggctggcca accagctcag cctcccgatg       360
     agtgcatgtc actttggcct gttcgacatc gctacttgcg aacgagcacg tctagcttgc       420
     cggcagtatc ttgagccctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page