(data stored in ACNUC9435 zone)

EMBL: AM039951.PE122

AM039951.PE122       Location/Qualifiers
FT   CDS_pept        132385..133605
FT                   /transl_table=11
FT                   /locus_tag="XCVd0122"
FT                   /product="putative integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19934"
FT                   /db_xref="GOA:Q3BZY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19934.1"
FT                   /translation="MTRPPAPRPTNEHTKRVRARSPYLVTPQARELQNALQALAAPPEG
FT                   PLVLADIPVVVLGVRFDLSPEQIERATAVLQDLYKHDIKPYADNSRKAIRSDWRHWVAF
FT                   CAQGDRVCMPVQLDDLVEFLNSLIAAGYKRATLEHLLFTLKLASRLWSCTCPTETLQFR
FT                   WYWQQQCREQLTARNHQAPALNVETVDNIVEAPTRASGLAGLLELRDMVYVSMSYDLLG
FT                   RASEMVRLRWSDVRFDADVDGGATCTIARSKTDQQGAGVALYLSPRSAHLLDTWQTQRL
FT                   LAADYLWPAARLEYLHNPYVFHRLPRHKLFKPGPTADAKRLRWDAHLNVREADRIIKRA
FT                   AGDQFSAHSARVGAAQDMTRAGMDLPAIMQQGRWNTPTMPARYAENELATRAGKNRQTA
FT                   LAKLKNS"
     atgacacgcc cccccgcccc tcggccgaca aacgaacaca ctaagcgtgt tcgagcaagg        60
     tctccctatc tggtcacacc gcaggcgaga gagctgcaga acgcactaca ggcgctcgct       120
     gcccctccag aaggtccact cgtcctggcg gacatcccgg tcgtcgtcct gggcgtgcgt       180
     ttcgatctga gcccagaaca gatcgagcgc gccacggcag tcctgcagga cctttacaaa       240
     cacgacatca agccgtacgc agacaacagc cgaaaggcga tccgatcaga ctggcgacac       300
     tgggtggcgt tctgcgctca aggcgatcgc gtctgcatgc ccgtgcagct cgatgacctg       360
     gtcgagttct tgaacagcct gatcgcggca ggctacaagc gcgcgacgct ggagcatttg       420
     ctcttcacgc tcaagctggc cagccgcctg tggagttgca cctgtcccac tgaaacactg       480
     caattccgtt ggtattggca acaacaatgc cgcgaacagc tcacggctcg aaatcaccag       540
     gcgcccgcac tgaatgttga gaccgtcgac aatatcgttg aagctccgac cagggcgtca       600
     ggacttgccg ggctgctcga acttcgcgac atggtctatg tatcaatgtc ctacgatctg       660
     ctcgggcgcg catccgaaat ggtgcgcttg cggtggagcg atgttcgctt cgatgcggat       720
     gtcgacggcg gagccacatg caccatcgcc cgctcaaaga cagatcagca aggcgctggc       780
     gtcgcgcttt acctatcgcc gcgttcggcc cacctcttgg acacgtggca gacgcagcgg       840
     ttgctggcgg cggactatct atggccagct gcgcgccttg agtacttgca caatccctac       900
     gtctttcatc ggctgcctcg acacaaactt ttcaagcctg gtccgactgc agacgccaag       960
     cggctgcgct gggatgcgca tctgaacgtg cgtgaagctg atcgaatcat caaacgtgct      1020
     gccggcgatc agttctcagc tcactcggcg cgcgtcgggg ctgcacagga tatgacgcga      1080
     gccggtatgg accttccagc catcatgcag cagggacggt ggaacacgcc aaccatgccc      1140
     gcgcgctacg cagagaacga gctcgctacc cgcgccggga aaaatcgcca aaccgcgctg      1200
     gcaaaactca agaacagctg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page