(data stored in ACNUC9435 zone)

EMBL: AM039951.PE123

AM039951.PE123       Location/Qualifiers
FT   CDS_pept        133673..134068
FT                   /transl_table=11
FT                   /locus_tag="XCVd0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19935.1"
FT                   /translation="MLTNEGTHQLVEESGLFDARTALNTLTRLEYNGLPVLASYDLTTT
FT                   KLRVTWNVPAQCRIQVPEPMVGETLAALRYLSGIALRRSFTKGIWRTTVVIASWQLTDV
FT                   DEDDDTEQDLSQTQATLHLALPFGSQI"
     atgctgacca acgaaggcac acaccagcta gtcgaggagt cggggctctt tgacgcacgt        60
     accgcgctca acacgctcac ccggcttgaa tacaatggac ttccggtcct tgcgagctac       120
     gacctcacga ctacaaagtt gcgagtgacc tggaacgtac ctgcacagtg ccggatccag       180
     gttcccgagc ccatggtagg tgagaccttg gccgcgcttc gttatctgag cggcatagca       240
     ctccgtaggt catttacgaa agggatctgg agaaccaccg tcgttattgc cagctggcaa       300
     ttgacggatg tggacgagga cgacgacact gagcaagacc taagccagac gcaagcgacg       360
     ttgcacctgg cacttccttt cggttcccag atttga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page