(data stored in ACNUC9435 zone)

EMBL: AM039951.PE128

AM039951.PE128       Location/Qualifiers
FT   CDS_pept        complement(138454..138753)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0128"
FT                   /product="histone-like family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19940"
FT                   /db_xref="GOA:Q3BZX6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19940.1"
FT                   /translation="MNKSALASAIAHRHAMTQAEASSIVDTVTEVVALMLLEHGRVNIN
FT                   RFGRFRLQHKPPRQARNPKTGETVQVGERVAVQFTAADELKRRFLDSKNGNRLE"
     atgaacaaaa gcgctcttgc atccgcgatc gcgcaccgtc acgcgatgac ccaggcagaa        60
     gccagttcca tcgtagatac agtgacagaa gtggtagcgc tcatgctgct ggagcatggc       120
     cgtgtgaaca tcaaccggtt cgggcgcttc cggctccagc acaaaccacc acgacaggcc       180
     cggaatccta agacgggcga gacggtccaa gtaggcgaac gcgtggctgt gcagttcacc       240
     gccgctgatg agttgaagcg ccgctttctc gactccaaga acggcaatcg gctcgaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page