(data stored in ACNUC9435 zone)

EMBL: AM039951.PE130

AM039951.PE130       Location/Qualifiers
FT   CDS_pept        139391..139768
FT                   /transl_table=11
FT                   /locus_tag="XCVd0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19942.1"
FT                   /translation="MVTALNALPVALVDSEAHAIWVHIRGRAAVKKSGQGAAFRRVVRA
FT                   DYAGRLRLHSNSPWRPFCPAAGDDQAIEVSLIRVGRILDKTEFDGPEWDRLQKHGLDAF
FT                   LIEAIATRSFRGAMRRIFGST"
     atggtcactg cgctgaatgc tctccccgtt gcgcttgtgg actctgaagc ccatgcgatc        60
     tgggtgcata tccgggggcg cgcggcggta aagaaatccg gccagggcgc cgcattccgc       120
     cgcgtggtgc gcgccgacta tgcaggccgc ctgcgcctcc attccaacag cccttggcgt       180
     ccattctgtc ccgccgcagg cgatgaccag gccattgaag taagcctgat ccgcgtcgga       240
     aggattctcg ataagaccga gttcgacggg ccagagtggg atcggctgca gaagcatgga       300
     ctggatgcgt tcctgatcga ggcgatcgcc acccggtcct tccgcggcgc catgcggcgc       360
     atctttggaa gcacctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page