(data stored in ACNUC9435 zone)

EMBL: AM039951.PE132

AM039951.PE132       Location/Qualifiers
FT   CDS_pept        140849..141427
FT                   /transl_table=11
FT                   /locus_tag="XCVd0132"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19944.1"
FT                   /translation="MRDILLATCLILGAAAAPAHASENISLHVKVTNGSKVLVDTNLLT
FT                   TPGAPAQARVGSDIRYVSSTTVYSRGKRSSLGGKKGTPVDRPPAERTYATLFDGVDITV
FT                   YPEPLAEAVGSPDKVLLRTRVSLSRLNGMEHTGEGDARIDLPSVQNFRTQSNTVVAWGS
FT                   PQVISYKSAGDEAADDYRIEVTPSTAKAR"
     atgcgcgata ttctgcttgc cacctgcctc attctcggtg ccgcagcggc accagcacat        60
     gcaagcgaga acatctcgct gcatgtaaag gtcacaaacg gcagcaaggt gcttgtcgat       120
     accaacttgc tcaccacgcc cggcgcgccg gcgcaggcgc gcgtgggcag cgacatcagg       180
     tacgtgagct cgacaacggt ctacagccgc ggcaaacgca gttccctggg cggcaagaaa       240
     ggaacgccgg tggaccggcc gccggccgag cgtacctacg ccacactgtt cgacggcgtc       300
     gacatcaccg tgtacccgga gccgctggcc gaagctgtcg gttcgcctga caaggtgctc       360
     ctgcgcacgc gcgtgtccct cagccgcctc aatggaatgg agcacaccgg cgaaggcgat       420
     gcgcgtattg acctgccttc cgtgcagaat ttccgcacgc aatccaacac tgtcgtcgcc       480
     tggggctccc cccaggtcat ctcctacaag tctgcaggcg atgaagcggc cgatgactac       540
     cgcatcgaag tgactcccag caccgccaag gcccgctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page