(data stored in ACNUC9435 zone)

EMBL: AM039951.PE135

AM039951.PE135       Location/Qualifiers
FT   CDS_pept        143593..143835
FT                   /transl_table=11
FT                   /locus_tag="XCVd0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19947.1"
FT                   /translation="MSALARLLDIPRAAPPHDLEHTLALLDDMRRQIDALGDISRNYGQ
FT                   LNHKLKQRKLQDIHLKLRDMRDDLAQRVVPSIKET"
     atgagcgctc tcgcacggct cttggatatc ccacgcgcgg cgccgccgca cgacttggaa        60
     cacacgctcg cactactcga cgatatgcgc cggcagatcg acgcactggg cgatatcagc       120
     cgcaactacg gccagctcaa ccacaagctc aagcaacgca agctccagga catccacctc       180
     aaactacgtg acatgcgtga cgacctcgcg cagcgcgttg tgccctctat caaggagacc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page