(data stored in ACNUC9435 zone)

EMBL: AM039951.PE136

AM039951.PE136       Location/Qualifiers
FT   CDS_pept        143837..144010
FT                   /transl_table=11
FT                   /locus_tag="XCVd0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19948.1"
FT                   /translation="MRIAVWPTGDWCEVKESAEFSQQNALGDDFAVYTAATVATAERIA
FT                   ANVEAGRPPLAA"
     atgcgtatcg ccgtatggcc caccggtgac tggtgtgagg tcaaggagtc tgcggagttc        60
     agccaacaga acgcattggg tgacgacttc gctgtctaca cggctgcaac cgttgccacc       120
     gctgaacgca ttgcagccaa cgtcgaagct ggccgccctc ccctcgctgc atag             174
//

If you have problems or comments...

PBIL Back to PBIL home page