(data stored in ACNUC9435 zone)

EMBL: AM039951.PE139

AM039951.PE139       Location/Qualifiers
FT   CDS_pept        146321..147313
FT                   /transl_table=11
FT                   /locus_tag="XCVd0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19951"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19951.1"
FT                   /translation="MKFNMIVDEGLRLAANMETRYDAWLQASRAIADGRLQWKTSGGHD
FT                   YLYRIIDSKGNGTSLGPRSPATEAMMESFQNAKLTVQNTWATLEREGKMYRSLRLPRIA
FT                   SYGAQVLRELDISGLLGDSVLVVGTNALCAYALEAGQLLSSTLDATEDFDLTWVRDVSN
FT                   APPALQAPSVFGVLKSVDSTYTINTERPFQARNSHGNEVELLIAESLAGLPTYERLRPI
FT                   PLPEQNWLLPGTRISHITCGMDGLPARVVAPDPRWFALHKLWLADKESRNVLKKGKDRE
FT                   QGDTVLHLVNDHMPHFPLDDAFEDSLPDELRPYFEDWKQENGLTPPGMR"
     atgaaattca atatgatagt cgatgagggc cttcggctgg cggccaacat ggagacccgc        60
     tacgacgcct ggctgcaggc ctcccgcgcc attgcagatg gccgtctgca gtggaagacc       120
     tccggcgggc atgactacct ataccgaatc atcgatagca agggcaatgg tacctcgctg       180
     ggaccgcgaa gccctgccac cgaagcaatg atggagtcgt tccagaacgc caagctaacg       240
     gttcagaaca cgtgggccac cttggagcga gagggcaaga tgtaccgctc cctgcgcctc       300
     cctcgcattg catcctatgg cgcccaggtt ctgcgagagc tggacatcag cggcttgctc       360
     ggtgactcgg tactggtcgt tggcacaaat gctctttgtg cgtacgctct cgaagctggc       420
     cagctgctga gctccacgct cgatgcgaca gaggacttcg acctgacctg ggtacgcgac       480
     gtaagcaacg cgccgccggc attgcaggcc ccttcggtat ttggcgtgct gaagagcgtc       540
     gacagcacct acaccatcaa taccgagcgc ccgttccagg cacgcaactc ccacggcaac       600
     gaagtggagc tgcttatcgc tgaatctctg gcgggcctgc cgacctacga gcggctccgg       660
     ccgattccgc tgccagagca gaactggctc ttgccgggta cgcgtatcag ccacatcacg       720
     tgcggcatgg acggcctgcc ggcgcgagtt gtcgcgcctg atccacgctg gtttgcgctc       780
     cacaagctgt ggctcgccga caaggagtcg cgcaacgtgc tcaagaaggg gaaggaccgg       840
     gagcagggtg acactgtgtt gcacctggtc aatgaccata tgccgcactt ccctctcgat       900
     gacgcgtttg aggactcgct gccggacgag ctccgcccgt actttgaaga ctggaagcag       960
     gagaacgggc taacgccgcc aggcatgcgc tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page