(data stored in ACNUC9435 zone)

EMBL: AM039951.PE142

AM039951.PE142       Location/Qualifiers
FT   CDS_pept        complement(149763..150383)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19954"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19954.1"
FT                   /translation="MTPNTDPVDRHQARVYALSAALASVLPYALSRAEDLHDLHDNGEA
FT                   DSHTPDAHLKAAAAYEGAQQLLQEVSIEAASRGLSARDVGSRLAFALELYSMAPFIGQQ
FT                   YGEYALQTAREAVRKWRLGSAGEGTTDAALMALARPLRECLEDYLDLPGITSQYGQVNF
FT                   DHGAGAVDAYWTLRLAELTPPAAHELVCVAGGEEVEDSPRPGV"
     atgactccga acaccgaccc cgttgaccgg catcaggcgc gcgtgtacgc gcttagcgct        60
     gcgttggcca gcgtactgcc atatgcgctc tcccgcgccg aggacctaca cgacctacac       120
     gacaatggcg aggccgacag ccacacgcct gatgcccacc tcaaagcagc ggcagcctat       180
     gaaggggccc agcagctgct gcaggaggtg agcattgagg cggcgtctcg gggactttct       240
     gcccgtgacg tgggctcgcg gctcgcattt gctttggagc tctattccat ggcgccgttc       300
     attggtcagc agtacggtga gtacgcgctg cagaccgcac gggaggctgt ccgcaagtgg       360
     cgccttggca gcgccggcga gggcactacc gatgccgcct tgatggcgct ggccaggccc       420
     ctgcgagagt gtctcgaaga ctatttggat ctgcccggca tcacgagcca gtatggccag       480
     gtcaactttg accacggcgc cggcgccgtg gatgcgtact ggaccctgag gctggcggag       540
     ctcacgccgc cagccgcgca cgaactggtg tgcgtggctg gcggcgagga agtcgaagac       600
     tcgccgcggc cgggggtata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page