(data stored in ACNUC9435 zone)

EMBL: AM039951.PE143

AM039951.PE143       Location/Qualifiers
FT   CDS_pept        complement(150380..151387)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19955"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19955.1"
FT                   /translation="MMIRGLPYEGNVILPVVLLGEGNQVIPFRDVCYRDLWRSDLVSEV
FT                   DPSAPEQGHAAYYTVLLTSGGADSAYDVDIDVLDYRSAELVGELCDSLHRAEKALMRAT
FT                   ARSVDPDQRVMAIQTIEDCARAWLRCNRAVPVTVNAEGALTQQPLARPRQGLCVDELES
FT                   SSSTAFWQVRELLPQAVSSLMVNLVDREDAKMFDFLYEQLITVREFGLTLRPWVMGGAQ
FT                   GEPPLSRSFYEALNVDPQPWAIPAFDLKPEAWLVALRERGFDFDPASTSIEDDLVDLRN
FT                   EDGEAVVGRRLASRIAWSVDHFCARHNLTREDLQLVARETMPAAADAASMGMKQ"
     atgatgattc gtggcttgcc gtatgaggga aatgtgatcc tccccgtggt cctcttgggc        60
     gagggaaacc aggtcattcc tttccgggac gtctgctacc gggatctctg gaggtcggac       120
     ctggtgagcg aggtggaccc atccgcgcct gagcaaggtc atgctgccta ttacacggtc       180
     ttactgacgt caggtggtgc ggattctgcc tatgacgtgg acatcgatgt gctcgactac       240
     cgctctgcgg agctcgtcgg tgaattgtgt gacagcctcc accgcgcaga gaaagctctc       300
     atgcgtgcaa cagcgcgcag cgtggaccct gatcagcggg tgatggcaat tcaaacgatc       360
     gaagattgtg cccgggcttg gctgcggtgc aatcgagccg tccccgtaac ggtgaatgca       420
     gaaggcgcgc tcacgcagca gcccctggcg cggccgcgcc aggggttgtg cgtggacgaa       480
     ctggagtcga gttcgtccac ggcgttctgg caggtgagag agcttctacc gcaggcagtt       540
     agctcactga tggtgaacct ggttgatcgc gaagacgcca agatgttcga ctttctgtat       600
     gagcagctga tcacggtccg tgaattcggc ttgacgcttc ggccgtgggt gatgggaggg       660
     gctcaggggg agccgccgct gagtcgcagc ttctacgagg cgctgaatgt ggacccgcag       720
     ccctgggcga tacctgcgtt tgatctcaag cctgaggcgt ggttggtcgc gctccgagag       780
     cgcggcttcg acttcgatcc tgcgagcacc tcgattgagg atgacctggt ggacctccgc       840
     aacgaagacg gtgaagccgt ggtaggacgc cgccttgcaa gcaggatcgc ttggtcggtt       900
     gatcacttct gcgcgcggca caaccttacg cgcgaagacc tgcagttggt ggctcgggaa       960
     acaatgcccg cggcggccga cgcggcatca atgggaatga agcaatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page