(data stored in ACNUC9435 zone)

EMBL: AM039951.PE144

AM039951.PE144       Location/Qualifiers
FT   CDS_pept        complement(151384..152028)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19956.1"
FT                   /translation="MRLTAASDSEQYIRSRPMKKQTLTYTKDPRYTVELDYTEGHPDDP
FT                   GAGTPAMVCGPNGTSGTFFCVRDTGWLNEGERNGHEVPPGVKQWLEEREDLVDGYVNAA
FT                   FAYASNHHRDAVSPADTEASPMIQEFTVASEGASLDEVEIVGASIDDDQFQFLLDTNGT
FT                   VYARDQNGVVMELSFDMDGESLVALPMKETATGLEQMSDDEWREHVPRMSP"
     atgaggctga ccgcggcttc agattctgag cagtacataa ggagcagacc catgaagaag        60
     caaacactga cctatacaaa ggatccacgc tatacggtcg aacttgatta caccgagggg       120
     catcctgacg acccgggcgc tggtacgccg gcaatggtct gtggaccgaa cggcacaagc       180
     ggtaccttct tctgtgtccg cgatacaggg tggttgaacg aaggcgagcg gaacgggcac       240
     gaggtgccac cgggggtgaa acagtggctt gaggagagag aggatttggt ggacggctat       300
     gtcaacgcgg cgttcgccta cgcatcgaat caccacagag atgcagtttc gcctgcggac       360
     actgaagcct cgccgatgat tcaggaattt accgtcgcat ccgaaggggc ctcgctggat       420
     gaagtagaga tcgtcggtgc atccatcgac gacgatcagt tccagttcct cctggacacg       480
     aacggtacgg tctacgcgcg cgatcagaac ggcgtagtga tggagctgtc gttcgacatg       540
     gatggcgagt cgctcgttgc gcttccaatg aaggaaaccg caacggggct ggagcagatg       600
     agcgacgacg agtggcgcga gcacgtgccg aggatgtcgc catga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page