(data stored in ACNUC9435 zone)

EMBL: AM039951.PE146

AM039951.PE146       Location/Qualifiers
FT   CDS_pept        complement(153499..153903)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19958"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19958.1"
FT                   /translation="MSVRRMVRAPISASTRDDLRRNCNTTQAVVETAARASKILEPRDA
FT                   YKEFRAAQDHFEVGCWLVYYRQQMAGEGAHEAIYECAELLRRHGLQEPTRNFETVFGFG
FT                   IDCYWSVVASQPRGRGAGEVCQMQPEVRAC"
     atgagcgtcc gacgtatggt gcgggcgccc atatccgcct cgacgcggga tgatctgcgc        60
     aggaattgca atacgaccca agcggtcgtt gagacggccg cgcgggccag caagatcctc       120
     gaacctcggg acgcgtataa ggagttccgg gccgctcagg atcattttga ggtcgggtgc       180
     tggctggtgt actaccggca gcagatggcg ggcgagggcg ctcacgaggc aatttatgag       240
     tgcgccgagt tgctccgtcg gcacgggctg caggagccga cgcggaactt tgaaactgtg       300
     ttcggttttg gcatcgactg ctactggtcc gtggtcgcga gccagcctcg gggccgcggc       360
     gctggtgagg tctgccagat gcagcctgag gtgcgagcat gctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page