(data stored in ACNUC9435 zone)

EMBL: AM039951.PE148

AM039951.PE148       Location/Qualifiers
FT   CDS_pept        complement(154705..155046)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19960.1"
FT                   /translation="MNVVKKPSIHYTLVSVDGCERTTSYCPASEGYRDYHDSGWTPREP
FT                   EQHTARAELEIDWGGGRHQMLKLEGHQHRDIEMYDKLPELLEAIGSGDQPETALQDALT
FT                   VESRPAMAG"
     atgaacgttg tgaaaaagcc gtcgatccac tacacgctgg tgagcgtaga tgggtgtgaa        60
     cgcacgacgt cgtactgccc ggccagcgaa ggctatcggg actaccacga cagcggctgg       120
     accccgaggg agccggagca gcatacggcc agggcagagc tggagattga ctggggtggc       180
     ggacgtcacc agatgctgaa gctggagggc catcagcacc gcgatatcga gatgtacgac       240
     aagctgccgg agttgctgga ggccatcggc agcggggatc agcccgagac cgcgctccaa       300
     gatgccttga cggttgaatc ccgtccggcg atggcgggct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page