(data stored in ACNUC9435 zone)

EMBL: AM039951.PE149

AM039951.PE149       Location/Qualifiers
FT   CDS_pept        complement(155461..155757)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19961"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19961.1"
FT                   /translation="MLIEVKVSRADFLADARKEHRIKPALGAGKWRYFMCPEGLINVDE
FT                   VSERWGLLWVSDKGTGWRRAAVMTGCSLRGRMRKSVVRMSLVQRASWIRRFAC"
     gtgctgatcg aagtcaaggt gtcacgcgcc gattttttgg ccgacgcgcg caaagagcat        60
     cgaattaaac ccgcgctagg tgccggcaaa tggcgctatt tcatgtgccc ggaaggtctc       120
     atcaatgtcg acgaagtgtc ggagcgctgg ggcctcttgt gggtgtcgga taagggcact       180
     ggatggcggc gagctgcggt gatgacgggt tgctcacttc ggggtcggat gcggaagagc       240
     gtcgtcagga tgagtctggt gcagcgcgcc agctggatac gtaggttcgc atgctag          297
//

If you have problems or comments...

PBIL Back to PBIL home page