(data stored in ACNUC9435 zone)

EMBL: AM039951.PE150

AM039951.PE150       Location/Qualifiers
FT   CDS_pept        complement(156028..156768)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19962"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19962.1"
FT                   /translation="MKRQPSMALAVVPVFQPVIDLLNGEALYFEALARSTSKRSHGELL
FT                   SFAETYGFIELVDLAMLDQATEFLARSPGIRIGVNASVSTIERNCGPLVAAVFMHLQEA
FT                   DRLVVEITESIAVTNPRVVHSFIAGVRAAGAKVAFDDFGDGCFSFEDIVRFNPDIVKLA
FT                   GVMLGRRSEYSRDISRVLALAEGQGFIVVAENIDTEEKRQACIDMGIRYGQGFLLGELA
FT                   STPIRTTAPASLDTRRDTRVSVKS"
     atgaagcggc agccgagtat ggcgctggct gtagttccgg tgttccagcc ggttatcgat        60
     ctcctgaacg gggaagcgct ctatttcgag gcgctcgcgc gaagcaccag caagcgtagt       120
     cacggcgagc tgctcagctt cgccgagacc tatggcttca ttgagctggt cgatctcgcc       180
     atgctcgacc aggcgactga attcctcgct cgctcgccgg gtatccggat aggtgtgaac       240
     gcatcggtga gcacaattga gcgcaactgc ggtcctctgg tggcggcagt gttcatgcat       300
     cttcaggagg ctgatcggtt ggtcgtggag atcaccgagt cgattgcggt cacgaatccc       360
     agggtggtgc attctttcat cgcaggcgtg agagctgcgg gcgccaaagt ggcctttgac       420
     gacttcgggg atggctgctt ctcattcgaa gacattgttc ggttcaaccc ggacatcgtg       480
     aagcttgccg gcgtgatgct cgggcgtcgt agtgagtaca gccgggacat ctcccgcgtg       540
     ttagcgctgg cggaagggca ggggttcatt gttgtcgcgg agaacatcga taccgaagag       600
     aagcggcaag cgtgcatcga catgggaatc cgctacggcc agggatttct gcttggggag       660
     ctcgcaagta caccgattcg gaccactgct ccggcttcgt tggacacccg gagagacact       720
     cgggtgtcag tgaaaagctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page