(data stored in ACNUC9435 zone)

EMBL: AM039951.PE151

AM039951.PE151       Location/Qualifiers
FT   CDS_pept        156843..156980
FT                   /transl_table=11
FT                   /locus_tag="XCVd0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19963.1"
FT                   /translation="MREHCSEQLAKLVRASTCSDRCHDMALVIHYFHTLTATRKLQPQF
FT                   "
     atgcgcgagc attgctccga gcagctcgcc aagctcgtgc gcgccagcac ctgcagcgac        60
     cgatgccacg acatggcatt ggtcatccat tatttccaca cgttgaccgc gacacgaaag       120
     cttcaacccc agttctga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page