(data stored in ACNUC9435 zone)

EMBL: AM039951.PE153

AM039951.PE153       Location/Qualifiers
FT   CDS_pept        159287..159685
FT                   /transl_table=11
FT                   /locus_tag="XCVd0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19965.1"
FT                   /translation="MTTTGRTKAKPVKSAAVRKGSATTTTARKSAPAKASTPAKTPPPA
FT                   QEVAGKSVVSPRSAEMKEARRFALTHNFGLSSRIRDLLDSKRPVLQIFIDENLPLAKVQ
FT                   EFIQRKYGPKIPAKALSTYLEANFKAKK"
     atgacgacga caggccgcac caaggccaag ccggtcaaga gcgccgctgt ccgaaagggc        60
     tctgcgacga caacgactgc ccgtaagagc gcgcccgcga aagcgagcac gccagcgaag       120
     acgccaccac cggcgcagga agtcgcaggc aaatcggtcg tgagccctcg cagcgctgag       180
     atgaaggaag ctcggcgctt cgcgcttacc cataattttg gtctcagcag ccgcatccgc       240
     gatttgctgg actccaaacg ccccgtgctg cagatcttca tcgacgagaa cctgcccctc       300
     gccaaggttc aggagttcat ccagcgcaaa tacggcccga agatcccggc caaagcgctt       360
     agcacttacc tggaagcgaa cttcaaagcg aagaagtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page