(data stored in ACNUC9435 zone)

EMBL: AM039951.PE154

AM039951.PE154       Location/Qualifiers
FT   CDS_pept        complement(159704..160042)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19966"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19966.1"
FT                   /translation="MSIWAQICEALPVPEEFGTECPYVRFSHVADDGGEGEDLTLEYQE
FT                   ADPASPATIQVSHSEWRLVAGQQRTLPLLSVTLQAESGEPVESESVRRIAASLAAALMQ
FT                   ASSFRLIR"
     atgagtatct gggcgcaaat ctgtgaagcc ttgccggtgc cggaggagtt cggcaccgag        60
     tgcccctacg tgcggttctc ccatgtggcc gacgacggcg gtgaaggcga agatctgacg       120
     ctcgaatatc aggaggcgga tccggcatcg ccagcgacga tccaggtgag ccacagcgag       180
     tggcgcctgg ttgccggtca gcagcgaacg ctcccgcttc tgagcgtcac tttgcaggcg       240
     gaaagtggcg agccggtcga gtctgaaagc gtgcggcgga ttgctgcctc gttggccgcg       300
     gcgctgatgc aggcatcttc gttccggttg atccggtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page