(data stored in ACNUC9435 zone)

EMBL: AM039951.PE155

AM039951.PE155       Location/Qualifiers
FT   CDS_pept        complement(160051..165309)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19967"
FT                   /db_xref="GOA:Q3BZU9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19967.1"
FT                   /translation="MRSSMDANTLVRWVRLDPANPRVRLVGAQFPSGTRKLVLLGGDQV
FT                   APSTLSALAQLGFYQSPRGLVLRDELKFTLGELRRAFPGAEPVEVPVGRVVRALPRRAN
FT                   AGDPVNSGDLQANNIIGAIRELGCNSAGETVFESELGRFARRDHEVVGRESELAGATGA
FT                   SRFLRAPDAVELAGCADGFVVEMRRGKPMRYADLRRWAAVVNDAAEEQVETSPLLRVWQ
FT                   EAVEAALVRTLGAHGAADVPAFELARRLEEGQPPFKARTTSSIVNQQYSTTLPLAVAVQ
FT                   HIAGDQRGKLLLEPTIGNASLVSLIRDATIHSVDIDPARVASVRRDRPDIVVSVGDFLA
FT                   DPPPSPATDGKFDTVLCNPPFGGLARPVMVDRLKVGRLDHLVLVNSLRLRRDDGLAVYI
FT                   VGGDNALDSKAGEVRGGSRYLFNWLADHYQVDVVEVDGGLYAKQGAGFPVRLVVIGAKG
FT                   ASASPIPERLDVLQDHESVIAWARNMRARYAQAPAPALLLKQVAVESTPAFDASHLDVS
FT                   SNRIVLSEATPEPMFDAMDLDLPADSIEAAVHTAQASTDHANPLPPGGEEDSAANVSAV
FT                   DENSYQSPYIAQSRVGEASAMIPRNLQTATRSALERIVDEHGDIDEFVAKNLHWRVDEM
FT                   REREYLSPEQVDAVALCIYAEQYGRGCLEGDQTGLGKGRVMAAMARYAVLRGRQTVFLT
FT                   ETPTLFTDFWRDVQDIGSADLFKPMIVNDGVPVYDPKSGETLVPATPRSTLQRALAEDA
FT                   IPSEFNLVLATYSQFNRNANTSAKARWISGAARDSQLLLDEAHNAAGDSNTGRNIAAAI
FT                   EASRSVTYSSATSMKGAKNVLIYSALFPQSVDVAGLPETLQTGGEVLQEVLSGMMARDG
FT                   VFIRREHDLSALTFDTVADSTRLERNIELSDKLAEILELMNFVSGDINVMVSERNKEIE
FT                   KLRELIPEQERKGARMGAISMNFGSRLFSIYRQFQMAIKTELAIDRAIAALEAGKKPVI
FT                   VLENTMESLLRDVITNSRADGFEDLDQELANAAAAVNAEQDLAAGVDLGQDIVFADVLR
FT                   RMLDKLRYYSETTGYGEVVRRDVTSKETLKLIASIESLIGEFPDLPASPLDQIRTRLEE
FT                   AGYAADELSGRSLRIERRTDGVTGEAKSVATVRPERPKARIVREFNMGETDALLLTRAG
FT                   STGISLHASEKFDDQRQRVLIELQSAADVNVRVQFFGRVNRKGQVSSPEVETLSSGLIG
FT                   EARPIAMQNAKMRKLSANTTANQDSAALDRNVPDFINVVGDQVARRYLESNPLIAHRLD
FT                   IDLDIEGDDSGFQQEAYFITKLTSRLVMLRNAEQEAIYEEITSEYTRIIKELDEKGLNP
FT                   FKSKDLDLRATEDSRIVFEGGNAQSGSVFEQPVFLKTISYTEEVLPLRPMDVKARCDRT
FT                   EARFDSAYGHPLARVLTRMAGSLERLAPKLLQEGAQGRKESVDELLAATEVNAVKRLRD
FT                   RIDFIARTLPRCAPGALTTFSGAENARTEGVMVDITLPNNEKKMHNPGQYTVLIAVPGQ
FT                   SQLVERSLYALMEDPAFSTRPVGSPASGLWEAFDAAPAGLITRTRCVLDGNLFKAAQMA
FT                   AANKIGSCVMYTDQHGARHRGVMLNAGIRPDHINSLRVRIETPSVASWLIQEHPDIQLS
FT                   TNSQGEYELDRHAAIERDGPLLKMTVPGTKAWGGKYFSSEPLCELTGEFAGTRAYMVAR
FT                   FSPDKLPEVLRILTSIGVSMYGPSEVRAAINDFILGKYGYTNDCDAGHPAFSLAG"
     atgagatctt cgatggatgc aaatacgctc gttcgctggg tgcgcttgga cccggccaat        60
     ccccgggtgc gtctggtagg tgcccagttc ccgtccggca cgcgcaagct tgtgctcctc       120
     ggcggcgacc aagtcgcccc gtctacgctc agcgctctgg cgcagctcgg cttctaccaa       180
     tctccacgtg gattggtgct gcgcgacgag cttaagttca cgctcggcga acttcgccgc       240
     gcgttccctg gcgccgagcc tgtggaggtt ccggttggcc gtgtagtcag ggcgctaccg       300
     cgcagagcga acgccggcga cccggtcaac agtggtgacc tgcaggccaa caacatcatc       360
     ggcgccatca gggagcttgg ctgcaactcg gctggggaaa ccgttttcga gagcgagctt       420
     gggagatttg cacgccgcga ccacgaggtg gtgggcagag agagcgagct tgcaggtgct       480
     accggcgcct cgcgctttct gcgggcgccg gatgcggttg aacttgcggg ctgcgctgat       540
     gggttcgtgg tcgaaatgcg gcggggcaag ccaatgcggt acgcagacct acggcgatgg       600
     gcagccgtgg tcaacgacgc tgccgaggag caggtggaga catccccgtt gctccgggtt       660
     tggcaggaag ccgtcgaggc cgccttggtg cgcacgcttg gcgcccatgg cgcggccgat       720
     gtgccggctt tcgagctcgc caggagactc gaagaaggtc agcccccctt caaggcaaga       780
     accaccagct cgatcgtaaa tcagcagtac tccacgacgt tgccgttggc agtggccgtc       840
     caacacattg cgggtgacca gcgagggaag ctcctgctgg agcccactat cggcaacgcg       900
     tcgctggtgt cgctgatccg tgacgcgacc attcattcgg tcgacatcga tcccgctcgc       960
     gtagcatcgg tccgtcgcga ccgtcccgac atcgtggtat ctgtcggcga cttcctggcg      1020
     gatccgccgc cgtcgccggc aaccgatggt aaattcgaca ccgtgctgtg caatccacct      1080
     ttcggcgggc ttgcgcgacc tgtcatggtc gacaggctga aggtgggaag gctcgatcat      1140
     ctggttctgg tcaactcgct gcgcctgcga cgagatgatg ggctagctgt ttacatcgtt      1200
     ggcggcgaca acgcactcga cagtaaggcg ggcgaggtca ggggagggtc gcgctacttg      1260
     ttcaactggt tggccgatca ctaccaggtc gatgtggtgg aggtcgatgg cggactgtac      1320
     gcaaagcaag gcgccggctt ccccgtgcgg ctggttgtca ttggcgccaa gggtgcaagc      1380
     gccagcccga tccctgaaag gttggacgtc ctgcaggacc acgagtccgt catcgcgtgg      1440
     gcgcgaaaca tgcgggcgcg ttacgcgcag gcaccggccc cggcgctgct gctgaagcag      1500
     gtagctgttg agtcgacccc ggcgttcgac gcctcacacc tggatgtgtc gtccaaccgg      1560
     atagtgctga gcgaggcaac gcctgagcct atgttcgacg cgatggatct ggatctgccg      1620
     gcagacagca tagaagctgc tgtacatacc gcgcaggcat ccaccgacca tgccaatcca      1680
     ctgccgccgg gcggcgagga ggacagtgcg gcgaacgtat cagctgtcga cgagaacagc      1740
     tatcaatcgc catacatcgc ccagtcacgc gtcggcgagg cgtcggcgat gattccacgg      1800
     aatctccaaa ctgccacccg ttcggccctg gagcgcatcg ttgacgaaca tggcgacatc      1860
     gacgagttcg tggcgaagaa tctgcattgg cgagtagacg agatgcgtga gcgcgagtac      1920
     ctgtcgcccg agcaggttga cgcggtcgcg ctttgtatct acgcagagca gtatgggcga      1980
     ggctgcctgg agggcgacca gaccggcctc ggcaaggggc gtgtcatggc tgccatggct      2040
     cgctatgcag ttctccgcgg caggcagacg gtcttcctca ccgagacgcc gacattgttc      2100
     accgatttct ggcgagacgt gcaggatatt ggatctgccg acctgttcaa accgatgatc      2160
     gtcaatgacg gcgttcctgt gtacgacccg aagtcgggcg agacgctggt gccggcgaca      2220
     ccgaggtcta ccctccagcg ggcacttgcg gaagatgcga ttccatcgga gttcaacctg      2280
     gtgttggcca cctacagcca gttcaatcgg aatgccaaca catcggcaaa ggccagatgg      2340
     atttccggtg cagcacgtga ctcgcagctg ctgctggatg aggctcacaa tgcggcgggc      2400
     gactcgaaca ccgggcgaaa tatcgcggcc gcgatcgagg caagccgctc ggtgacctat      2460
     agctctgcga cctcgatgaa gggagcaaag aacgtgctga tctatagcgc gctcttcccg      2520
     caatctgttg atgttgccgg tctcccggag accttgcaaa caggcggtga agttctccag      2580
     gaggtgctgt caggaatgat ggcccgcgac ggagtattca tccgccgaga gcatgacctg      2640
     agcgcgctta cgttcgatac ggtggctgac agcacccgcc tggagcgcaa catcgaacta      2700
     tcggacaagt tggccgaaat ccttgagctg atgaacttcg tttccggtga catcaatgtg      2760
     atggtcagcg agcgcaacaa agaaatcgaa aagctgcgtg agctgattcc tgagcaagag      2820
     cgcaagggcg cgcgcatggg cgcgatatcg atgaacttcg gatcccgcct gttctcgatc      2880
     taccggcagt tccagatggc gatcaagacg gagctggcga ttgaccgcgc gattgcggcc      2940
     cttgaggctg gcaagaaacc agtaatcgta ttggagaaca ccatggagtc cctgctcagg      3000
     gacgtaatca ccaacagccg ggccgatggc ttcgaggacc tggaccaaga gctggcgaac      3060
     gccgccgccg ctgtcaacgc cgagcaggat cttgcggccg gggtagacct tggccaagac      3120
     atcgtgtttg ccgatgtgct ccggaggatg ttggacaagt tgcgctacta cagtgaaaca      3180
     actggctatg gcgaggtagt tcggcgggac gtaaccagca aggaaacgct taagctcatc      3240
     gccagcatcg agagcttgat cggagagttt cccgatcttc ccgcctcgcc gttggatcaa      3300
     atccgaacgc gtcttgaaga ggcagggtat gccgcggacg agcttagtgg gcgcagtttg      3360
     cgcatagagc gacgcacaga tggtgttacc ggcgaagcta agtccgtggc cactgtcagg      3420
     cctgagcgcc ccaaggcacg gatcgtgcgc gagttcaaca tgggagaaac cgacgcgctc      3480
     ctgctcacgc gggctggctc gaccggcatc tcattgcacg ccagcgagaa gttcgacgac      3540
     cagaggcaac gggtgttgat cgagctgcag tcggctgccg atgtgaatgt gcgggtccag      3600
     ttcttcggac gggtgaaccg caaaggccag gtcagcagcc ccgaagttga gacgctctcc      3660
     tcggggctaa ttggcgaggc acgccccatc gcgatgcaga acgcgaagat gcgaaagctc      3720
     tcggccaaca ccacggccaa tcaggattcg gccgcgctgg acagaaacgt gcccgacttc      3780
     atcaacgtgg tcggcgacca ggtggcaaga cggtatctcg aaagcaatcc gttgatcgcg      3840
     catcgactcg acattgatct tgatatcgaa ggcgacgatt cggggttcca gcaagaggcc      3900
     tatttcatca ccaagctcac cagcaggctg gtgatgcttc gtaatgccga gcaggaggcg      3960
     atctacgagg agatcaccag cgagtacacc cggatcatca aggaactgga tgagaagggc      4020
     ttgaacccgt tcaaatcaaa ggatctggat cttcgcgcca ccgaggattc tcgaatcgtt      4080
     tttgagggtg gtaacgctca gtccggttcg gtgtttgagc aacctgtctt cctcaaaacc      4140
     atcagctaca ccgaagaagt gctgccgctg cgtccgatgg atgtcaaggc ccgttgcgat      4200
     cgcacggagg cgcgctttga ctcagcttat ggacacccgc tggcgcgcgt cctgacccgc      4260
     atggcgggct ctctggagcg attggcgccc aagctgctgc aggagggcgc tcaaggccgc      4320
     aaggagagcg tagacgagct attggccgcc acagaagtta atgcagtaaa gcgcctccgc      4380
     gatcgcattg acttcattgc gcgaacactg ccgcgatgtg cgcctggcgc gctgacgacg      4440
     ttctccgggg ccgaaaacgc cagaacggaa ggcgtgatgg tggacatcac gttgccgaac      4500
     aacgagaaga agatgcataa ccccgggcaa tacacggtcc tcattgccgt gcctggtcag      4560
     tcccagctgg tggagcgcag cttgtatgcg cttatggaag accccgcatt ctcgacgcgc      4620
     ccggtcggct cgcccgcgtc tggtctttgg gaggctttcg acgcggcccc tgcagggctg      4680
     ataacccgga cgcggtgcgt cctggatggc aatctgttca aggcggctca gatggcagcg      4740
     gccaataaga tcggcagctg cgtcatgtac accgatcagc atggcgcgcg gcatcgcggc      4800
     gtgatgctca acgccggcat caggcccgac catatcaatt cgctgcgtgt gcgtatcgag      4860
     accccttcgg tagcttcatg gttgatccag gagcatccgg atatccaact gtcgacgaac      4920
     agccaggggg agtatgagct cgaccggcac gcggccatcg agcgggatgg cccactgttg      4980
     aaaatgacgg tgccaggcac gaaggcctgg ggcgggaagt acttcagcag cgagccgttg      5040
     tgtgagctca ctggggagtt cgccggaacc cgcgcctaca tggtggcccg gttttccccg      5100
     gacaagctgc ctgaagtcct caggatcctc acttccattg gtgtatcaat gtatggacct      5160
     tctgaggtcc gcgccgccat taacgatttc atcctcggca aatatggata tactaacgat      5220
     tgtgacgcgg gccatcccgc gttctccctg gcaggatag                             5259
//

If you have problems or comments...

PBIL Back to PBIL home page