(data stored in ACNUC9435 zone)

EMBL: AM039951.PE156

AM039951.PE156       Location/Qualifiers
FT   CDS_pept        complement(165376..166632)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19968.1"
FT                   /translation="MSALRSLRESAAPKGGGRTPNTFAAVLQVSTAVVEKVGDKESLKL
FT                   TGIVLNEVPGAGRDLPVAVEFRGDDAERAVSNFVKGHGGSRKIFDKPENAAGSVLTLES
FT                   CYLTDQMSDDDRMVVSSRWVNTLQKVNEATHSDRSFLEGVMATSPRVSFENPNYREGNE
FT                   EPRTITIPVSQEKFTARVQTEHGTFSREFDRAWGIERLNKLSKDAKPSVFIDTVEPNNA
FT                   KLVTSEEELRAALTEQLGRGTRALALLRVTDGEEVIDRLVYGQYKREGDEYLPDPAATL
FT                   EELFKNNVFRDIANTDLLAGLADGTLKIDSIPGYRLSYAGNPLKDDNAAYKLVSDLKAN
FT                   KVTRYEIAFGKEPNRFASVVLPGVARNDTIAGFSPINVIADRPGRHAAHEIATAHIDAK
FT                   AQAAVAPEPEDEPADSPAP"
     atgtccgcac ttcgctccct gcgtgagtcc gccgccccga agggcggtgg ccgcaccccc        60
     aataccttcg ccgccgtcct gcaggtgtcc accgctgtgg tcgaaaaggt cggcgacaag       120
     gaaagcctca aactgaccgg catcgtgctc aacgaagtgc ccggtgcagg ccgcgacctg       180
     cctgtggcag tggagttccg cggcgacgac gcggaacgcg cggtgagcaa tttcgtgaag       240
     ggccatggcg gtagccgaaa gatctttgac aagccggaga atgcagccgg ctcggtcttg       300
     acccttgaat cctgctacct gaccgaccag atgtccgacg acgaccgcat ggtcgtcagt       360
     tcgcgctggg tcaacacgct gcagaaggtc aacgaggcca cgcactcgga ccgcagcttc       420
     ctggaaggcg tgatggccac ttcgccgcgc gtcagcttcg agaacccgaa ctaccgcgag       480
     ggcaatgaag aaccgcgcac catcacgatt ccggtctcgc aggagaagtt caccgcacgc       540
     gtgcaaaccg agcacggcac gttctcgcgc gagttcgacc gcgcatgggg catcgagcga       600
     ctgaacaagc tgtcgaagga cgccaagccg tccgtcttca tcgacaccgt cgagccaaac       660
     aatgccaagc tggtgaccag cgaagaagag ctgcgtgccg cgctgaccga gcaactgggc       720
     cgtggcacgc gcgccctggc gctgctgcgc gtcaccgatg gcgaggaagt catcgatcgc       780
     ctggtgtatg gccagtacaa gcgtgaaggt gacgagtacc tgcccgaccc ggcagcaacc       840
     ctcgaagagc tgttcaaaaa caatgtgttc cgcgacatcg ccaacaccga cctgctggct       900
     ggcctggccg acggtacgct caagatcgac tcgatcccgg gttaccgtct gagctatgcg       960
     ggtaacccgc tcaaggacga caacgcggcc tacaagctcg tctcggatct gaaggcgaac      1020
     aaggtgaccc gctacgagat cgccttcggc aaggaaccaa accgctttgc gagtgttgtc      1080
     ctgccgggcg tggcgcgtaa tgacaccatt gccggcttct cgccgatcaa cgtgatcgcc      1140
     gatcggcccg gccgccatgc cgcgcacgaa atcgccacgg cgcacatcga tgccaaggcc      1200
     caggcggcag tggcgccgga accggaagat gagccggccg acagcccggc tccgtaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page