(data stored in ACNUC9435 zone)

EMBL: AM039951.PE157

AM039951.PE157       Location/Qualifiers
FT   CDS_pept        complement(166833..167162)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19969.1"
FT                   /translation="MMPAHGQSCTVQLGVPVGAAAEAKDLASAVWAHAAPAFGGQTSVR
FT                   EALERLRADPMRTRDIGFALRLADEVAPSPAAAHTAPLVLRNLVAELAGLTTVEEHKQL
FT                   AASWQ"
     gtgatgccgg cgcacggcca aagttgcacg gtgcaactcg gcgtgcccgt tggcgcagca        60
     gcggaggcga aggacctcgc aagtgcggtt tgggcccacg ctgcgccggc attcggtgga       120
     cagacgagtg tgcgtgaagc gctcgaaagg ctccgggcgg atccgatgcg gacccgagac       180
     attggctttg cgttgaggct agccgatgag gttgcgccct caccagctgc tgcgcacacg       240
     gcgccgctgg tgctgcgaaa cttggtggct gaactggctg gcttgacgac tgtcgaagag       300
     cataagcagc ttgccgcgtc ttggcagtag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page