(data stored in ACNUC9435 zone)

EMBL: AM039951.PE158

AM039951.PE158       Location/Qualifiers
FT   CDS_pept        complement(167159..167962)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19970"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19970.1"
FT                   /translation="MSKTKISVSGLAHLLAQLLGYDIYTLSRAANIPRANVASWLGGNI
FT                   RGLRVNTIVELMGMLGLRLDAGAWRLDSQRVHFWRVKLGAFTKVEDALAAVELLSRLLG
FT                   ANSAITQVHPPKAVRGRSGLARTDQYMIGGGQCRVVVSVTQPFFRKVRVTPDVAKGTMW
FT                   RDDNRHHTMQIQASHWRQVLARDMTVKEFDQAFEQSMGAMDWGDLALAARQFNLTPEDL
FT                   LGWVRERYEPDTGSQAAADDIEVAGSQNVILLGRDIAPRRTGSYG"
     atgtcgaaaa cgaaaatctc ggtgagcgga ctggctcatc tgctggcgca actgttggga        60
     tacgacatct atacgctctc tcgggccgcg aatatcccac gcgccaacgt agcctcctgg       120
     ctgggtggca atattcgcgg ccttcgcgtg aataccatcg tcgagctgat gggtatgctt       180
     ggcctccgac tggacgccgg cgcatggcgt ttggactccc agagggtcca tttttggcgc       240
     gtgaagcttg gtgcgttcac caaggtggag gatgcgttgg cggcggtgga gctgctctca       300
     cggctgctgg gcgccaactc tgcgatcacg caggtccatc caccgaaggc tgttcgcggg       360
     cggagcggcc tggcgcgcac ggatcagtac atgatcggtg gcgggcagtg ccgcgtggtc       420
     gtgtccgtca cgcaaccctt cttccgcaag gtccgggtga ccccggatgt ggccaagggg       480
     acgatgtggc gcgacgacaa ccggcatcac acgatgcaga tccaagcttc gcattggcgc       540
     caggtgctcg cccgcgatat gacagtcaaa gagttcgacc aggccttcga acagagcatg       600
     ggtgcgatgg actggggtga cctagcgctg gccgcacggc agttcaatct gacccctgaa       660
     gatctgctgg ggtgggtgcg cgagcgctac gagcctgaca cgggtagcca ggctgcagct       720
     gacgacatcg aggtggctgg atcgcagaat gtcattctgc tcggtcgtga catcgcgcca       780
     cgtcgaactg gatcctacgg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page