(data stored in ACNUC9435 zone)

EMBL: AM039951.PE159

AM039951.PE159       Location/Qualifiers
FT   CDS_pept        complement(168022..168681)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19971.1"
FT                   /translation="MTTKVANDEAESAMRSRMAAALGFVVGTQRWQGVSLQKVAVEAET
FT                   HRSNLSSFIRSHGGRRNISDVKLRAVLFALGLHWDLTLTRSLHRWDLGAEDHLMGGLRV
FT                   LLDVMGRYSVGVVTTAGCRESFFLLIADGGAVAMLRATGEVASGVAKLLGVDRILVDSD
FT                   RAVSEAVQRIWLTQDVAVAEKMVRGLMDSCGVAEVGIGRRDEAIREHESRQLIATA"
     atgacaacga aagtggctaa cgacgaagcc gaatccgcaa tgcgtagccg tatggctgca        60
     gcgttgggct ttgtggtggg gacccagcga tggcaggggg tttcgctgca gaaggttgcc       120
     gtggaagcgg agacgcacag gagcaacctg tcgtccttca tccgcagtca tggcggccgg       180
     cggaacattt ccgatgtcaa attgcgcgcg gtgcttttcg cgctgggcct ccattgggat       240
     ctgacgctga ccaggtccct gcacaggtgg gacttgggcg ctgaggacca tctgatgggc       300
     ggcttgagag tgcttcttga tgtcatgggt cgatattcgg tcggcgtcgt taccactgcc       360
     ggttgtcggg agtcattttt cctgttgatc gcggatggag gtgctgtggc catgctgcgt       420
     gcgaccggtg aggtcgcctc cggtgtcgcc aagttgctcg gcgtcgacag gatcctggtc       480
     gacagcgaca gggcagtttc ggaagccgtc cagcgaatct ggctgacaca agatgtggcc       540
     gtggcagaaa agatggtgcg tggcctgatg gattcctgcg gcgttgcaga ggtgggcatt       600
     ggtcggcgag acgaggcaat acgtgaacac gagagccggc aattgatcgc gacagcctaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page