(data stored in ACNUC9435 zone)

EMBL: AM039951.PE160

AM039951.PE160       Location/Qualifiers
FT   CDS_pept        complement(168678..169250)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19972"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19972.1"
FT                   /translation="MALVVHGDGCMTNLHAMRRKVHADSLKPRNIELVPATGALGIQFE
FT                   RGSNRGGGFRRCGVVHMAIPSEWTLNLTSGQPSAEVFDPVARRAQGDESIEALQQQAFV
FT                   ERPHLVAFHRMLVSLTAADLASAARGGRDQRLEAGPGGHTYIAADVLVPAAGRDQFDAE
FT                   AWLSGHGHGLLRCSRKCTIIVRSKACK"
     gtggcgctag tagtccatgg cgacggatgt atgaccaacc tccacgccat gcgccgcaag        60
     gtccacgccg actcgctgaa gccacgaaac atcgagctgg taccggcaac gggagcgttg       120
     ggcattcagt tcgagcgcgg ctcgaaccgc ggcggcggct tccgcaggtg tggtgtggtt       180
     cacatggcaa taccaagcga gtggacgctg aacctgacct cgggccagcc atcggccgag       240
     gtgtttgacc ccgtggcacg ccgggcacaa ggagacgagt cgatcgaggc gctgcagcag       300
     caggcgttcg tcgaacgtcc acacctcgtg gcattccacc ggatgctggt gtccttgacc       360
     gccgcagatc tcgcatcggc cgccagaggc ggtagagatc agagactgga ggcgggacca       420
     ggtggtcaca cgtacattgc tgcggacgtt cttgtaccag cagctggaag ggatcagttc       480
     gatgctgagg cgtggctgag cgggcacggt catggcttgc ttcggtgttc gcgaaagtgc       540
     actattattg ttagatcaaa ggcctgtaaa tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page