(data stored in ACNUC9435 zone)

EMBL: AM039951.PE161

AM039951.PE161       Location/Qualifiers
FT   CDS_pept        complement(169241..169597)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0161"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19973.1"
FT                   /translation="MLALINMAGVFGAAQAQVVNRLTPPQLEPAAAASTPTQAASRAPV
FT                   TEYAPISPPAASVLTVVSPLQDQIAAELAFLPNETNDEYTERMRTRYDQVKKNAQRVDA
FT                   EHAARMRALVQAWR"
     atgctcgcat tgatcaatat ggctggcgtt tttggcgccg cacaggcaca ggttgttaac        60
     cggctgaccc caccccagtt ggagccggcc gctgccgcca gtacgccgac gcaggccgcc       120
     tctagggcgc cggttaccga atacgcgccg atatctccgc cggcggccag cgttctgacg       180
     gtagtttctc ctttgcagga ccaaatcgcc gctgagctgg cgttcctgcc caacgagacc       240
     aacgacgaat acaccgagcg tatgcgcacc cggtacgacc aagtcaagaa gaacgcgcag       300
     cgtgttgacg ctgagcacgc tgccaggatg cgggcgctgg tgcaggcgtg gcgctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page