(data stored in ACNUC9435 zone)

EMBL: AM039951.PE163

AM039951.PE163       Location/Qualifiers
FT   CDS_pept        complement(172923..174167)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19975"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19975.1"
FT                   /translation="MGAKYFGSVRFDIDDPNAGGWASVEGGEAFRIANASSLDSSTVWW
FT                   TNLSFDSMWKANIHRLPNVKRTTYMHSWRRGDGQDAFCESWGLVRRRYTEKTIAEALSA
FT                   IFAQVMRVAARRYNVDLSQREVFPYDTLADEIRSRLLPVADPSLGPEADGAIGESHLYY
FT                   NTCMTPHHRTEDYVDVCFSKPAVAYAREMTQTIIPSDQVEYLDQQSLPPFGKRLDWVLN
FT                   DPRPVLARVSVADVHPDFANLISYGNGGRAGTNRNWLTQPEILLLSNFARVEIESAYVF
FT                   SEYRQMPSQCLLPDDITDLQAMTPNTQILATNHWIGLCRENPYRLEPGKSSERRTSPRA
FT                   AWLTSVDRFQMFTNALSLHQAGFTVCYYGAGVVVARVPKYNYRDAYEVAVSAGMLAPTT
FT                   MSEDIDVQEDLQDVG"
     atgggggcta agtacttcgg ctcggttcgg ttcgacatcg acgacccgaa cgccggcggc        60
     tgggcttcag ttgagggcgg cgaggcattc cgaatagcca acgccagcag cctggacagt       120
     tctaccgtgt ggtggacgaa cttgtcattt gacagcatgt ggaaggcgaa cattcaccga       180
     cttccgaacg tcaagcgcac tacctatatg cactcgtggc gtcgcggcga tggacaggac       240
     gcgttctgcg agtcatgggg gctggtgcgg cgccgataca ccgagaagac gatcgccgag       300
     gcgctgagtg cgatcttcgc gcaggtgatg cgcgtcgctg cacgccgcta caacgtggac       360
     ctgagtcagc gcgaggtgtt tccgtacgac acactggccg acgagattcg gtcacggctc       420
     ctgccggtgg ctgacccgag cttggggccc gaagccgatg gcgcgatcgg tgaatcccat       480
     ctctactaca acacctgcat gacgccccac caccggactg aagactacgt cgacgtgtgc       540
     ttctccaagc ctgcagtggc ttatgcccgc gagatgacgc agaccatcat tccttcggat       600
     caggtcgagt atctggacca gcaaagtctc cctccgttcg ggaagcgctt ggactgggtc       660
     ctcaacgatc cacgcccagt gcttgcgcgt gtctcggtag cagatgtgca ccctgacttc       720
     gccaatctca tctcctacgg caacgggggc agggcaggga cgaaccggaa ctggctgacg       780
     cagccggaga tccttctgct gtcgaatttt gccagggtcg agatcgaatc ggcctatgtg       840
     ttttcggagt accggcagat gccttcgcaa tgtctgctcc cagacgacat cacggacctg       900
     caggcgatga cgcccaacac gcagatcctg gcaacgaatc actggattgg cctgtgtcga       960
     gagaatccat atcgattgga accagggaag agcagcgaac ggcgaacctc gccacgtgcc      1020
     gcgtggctga cgtcggtaga tcggttccag atgttcacca atgcgctgag cctgcaccag      1080
     gcgggtttca cggtctgcta ctacggtgca ggagtcgtag tggcacgagt gcccaaatac      1140
     aactatcggg atgcctacga ggttgctgtt tcggcgggaa tgcttgctcc gaccacgatg      1200
     agtgaggaca tcgacgtgca ggaggatctc caggatgtcg gttga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page