(data stored in ACNUC9435 zone)

EMBL: AM039951.PE165

AM039951.PE165       Location/Qualifiers
FT   CDS_pept        complement(174921..175325)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0165"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19977"
FT                   /db_xref="GOA:Q3BZT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19977.1"
FT                   /translation="MMIRNKRTWLAMATLLLVCLSLLTPFGAFAQDQMSGAPDVKTIAQ
FT                   NGTETANGVFTLIQSLVCLVGFIIVCIGVYGFYRVNKEKGQGQASIATSFVGCIVGVLM
FT                   VMLPLTVGTLGKTVFGDQAGRPQRINITPQ"
     gtgatgatcc gtaacaaacg aacctggctc gcaatggcaa ccctgctgct ggtgtgcctt        60
     tcccttctca ccccgttcgg cgcattcgca caggatcaga tgtccggcgc gccggacgtc       120
     aaaacgatcg ctcagaatgg aaccgaaaca gccaacggcg tcttcacgct catccagtct       180
     ttggtgtgcc tggtcgggtt catcatcgtg tgcatcggcg tgtatggctt ctaccgcgtg       240
     aacaaggaga agggtcaggg acaggcgtcg attgccacgt ccttcgttgg ctgcatcgtg       300
     ggtgtgctca tggtgatgct gccgctgacc gttgggacgc tcggcaagac ggtgtttggc       360
     gaccaggccg gtcgtccgca gcgcatcaac atcaccccgc agtaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page