(data stored in ACNUC9435 zone)

EMBL: AM039951.PE171

AM039951.PE171       Location/Qualifiers
FT   CDS_pept        complement(180223..180744)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19983.1"
FT                   /translation="MQPVHPDNHVFTVAGRVAGLGDQKGAYVIATSPEELVARFRDWDF
FT                   EVTSIASLADVRQSVEILDAIASCSAEVGAEEYLDLFPVEPGQRRQSSNVFTFVGKYVG
FT                   GGRVSEATAMAGFGTAADASALSGYLRSAGFDVLSVMSHSEALDLQAEMRLVACDALAD
FT                   EAHLVNLKEL"
     atgcagccgg tccacccaga caaccacgtg ttcaccgtcg ccggccgcgt cgccgggctc        60
     ggagaccaga agggcgcgta cgtcattgcc acctctccag aggagctggt cgcacgattt       120
     cgtgattggg atttcgaggt cacatctatc gcaagcctgg cggacgttcg tcagagcgtt       180
     gagatcctgg acgcaattgc gtcatgcagc gcagaagtgg gggctgaaga gtacctcgac       240
     ttgtttccgg tagagccagg tcagcggcgt caatcgtcca acgtgttcac tttcgttggc       300
     aaatatgtcg gcggcggccg tgtctcagag gctaccgcaa tggcaggatt cggtacggct       360
     gctgacgcct cggcgctctc ggggtacctt cgttccgctg gcttcgatgt gctgtcggtc       420
     atgagccaca gcgaggcctt ggatttgcag gctgaaatga ggctggttgc ctgcgacgcg       480
     ctcgccgatg aagcgcactt ggtgaatctg aaagagctgt ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page