(data stored in ACNUC9435 zone)

EMBL: AM039951.PE172

AM039951.PE172       Location/Qualifiers
FT   CDS_pept        complement(181061..182371)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0172"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19984"
FT                   /db_xref="GOA:Q3BZT2"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19984.1"
FT                   /translation="MTALAKPASHSKQSHQDRNECDKAPANMIVRKHVGAIQIFNSLTL
FT                   LQRKVFAALLLNGYDELPNFSIISHQIPIGVLSYLAGFNSKNTPYLKESLTGLVTSPVQ
FT                   WNILRSDGRAAWAVSATLASARIEDGVVYYSFSPELRKRLYDPEVSGVLSASVTRLMKS
FT                   SPALALYENCMVYAEEGVTPAFALPDLKGLLGVAGNSTYDDFGKFKDKVLNPACREVNR
FT                   VAPIQLEPILNRSARKVVSVAFAIKILGDGGSDKMREQADPFHGRDTDLVTRLQEEMTL
FT                   GYGSVVKLFEQHSDERLRAVRDYVVARFQEGKVQKHKLAPYFLRVAENATPESLSQKQT
FT                   TLTLEARKPASEKPKDEATLAAESAEAERRLQLQARLHTAEARLDALDSEQRAKLEESF
FT                   RQQLAADNKLIYDSLRKHEFSGPLYRKLLIQHVAAND"
     atgaccgcac tcgccaaacc agcctcccat tcaaagcagt cgcaccagga ccgcaacgaa        60
     tgcgataaag caccggcgaa catgatcgtg cggaagcatg tgggtgccat ccagatcttt       120
     aatagtctga ccctgctaca acgcaaggtt ttcgccgctc tgctcctcaa cggctatgac       180
     gagctgccga acttcagcat catttcccac caaatcccta ttggcgtgct gtcctacctc       240
     gctggtttca acagcaagaa cacgccttac ctgaaagagt cactcacggg gctggttaca       300
     tcccccgtgc agtggaacat tctgcgctcc gacgggcgcg ctgcctgggc agtgagcgcc       360
     acactcgcct ctgcgcgcat cgaagatggg gttgtctact actccttcag tccggagctg       420
     cgcaagcgcc tctacgatcc cgaagtcagc ggagtgctta gcgcaagcgt tacgcgcctg       480
     atgaagagca gtcctgcatt ggcgctgtac gagaactgca tggtgtacgc ggaagagggc       540
     gtgacaccgg cttttgctct gccagacctg aagggattgc tgggggttgc cggcaactcc       600
     acgtatgacg acttcggcaa gttcaaagac aaggtgttga acccagcttg tcgcgaagta       660
     aatcgcgtgg cgccgatcca acttgagccc attctcaata gaagcgcccg caaggtagtg       720
     agcgttgcat tcgcgatcaa gatccttggc gatggcggct cggacaaaat gcgagagcag       780
     gccgatccgt tccatggccg cgataccgat ttggtgacgc gcctgcagga agagatgacc       840
     cttgggtatg gatctgtagt caagttgttc gagcagcact ccgatgaacg actacgcgcg       900
     gtgcgagact acgtggtagc gcgctttcag gagggcaagg tacagaagca caagctggca       960
     ccgtacttcc ttcgtgtggc cgaaaatgcc acgcctgaaa gcctgtcgca gaagcagacc      1020
     acattgacct tggaagcacg caaaccagca agcgagaagc ccaaggacga ggctacgctt      1080
     gcggctgaat ctgcggaagc cgagcgtagg ctgcagctac aggcgcgcct tcataccgca      1140
     gaagctcgat tagacgcact cgattccgag cagcgagcca agctggaaga gagcttccgg      1200
     cagcaactgg cagccgataa caaactgatc tatgactccc tacggaaaca cgaattctct      1260
     ggccccttgt atcggaagct gctaatccag catgtggccg cgaacgactg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page