(data stored in ACNUC9435 zone)

EMBL: AM039951.PE18

AM039951.PE18        Location/Qualifiers
FT   CDS_pept        22121..22471
FT                   /transl_table=11
FT                   /locus_tag="XCVd0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19830"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19830.1"
FT                   /translation="MSLNDFIDGQLVNNTFNRRAVAETANNRDEWMAEAKRLRRELEAT
FT                   IADRDTWKAHGTASIELVRDLRENLAQSSPANPFADRNRLNERLKARKVELVQQMGYRV
FT                   INADADNFTITR"
     atgagcctca acgatttcat cgacggtcag ctggtcaaca acactttcaa tcgtcgggcg        60
     gttgctgaga ctgctaataa ccgcgatgaa tggatggctg aggcaaagcg cctgcgtaga       120
     gaacttgagg ccacgatcgc cgatcgggac acctggaaag ctcacggtac tgcctcgatc       180
     gagctcgtac gggacttgcg cgaaaatctt gcgcagtcta gtccagcgaa cccattcgcg       240
     gatcggaaca ggcttaacga gcggctgaag gcgcgcaagg tggagctggt gcagcagatg       300
     ggctaccgag tcatcaatgc ggacgcagat aatttcacca tcacgcgctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page