(data stored in ACNUC9435 zone)

EMBL: AM039951.PE19

AM039951.PE19        Location/Qualifiers
FT   CDS_pept        22586..23095
FT                   /transl_table=11
FT                   /locus_tag="XCVd0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19831.1"
FT                   /translation="MTWRTPSSLKWLIVKHSRLQGEIELLRREAEELDTQVVAQRQRLE
FT                   RAEKNLLAIETSLGMHEVQVDVGDIAAVIPHVNQPIYRHGDLTRNLYAALRIAGDWLTT
FT                   GELVERLTGHTYENCDRKLYERIRRSFRKRLTSLVSKGSVEREFSQGTTDCRQNHTRWR
FT                   LLSGRH"
     atgacttggc gcaccccatc ctcactcaag tggttgatcg taaagcactc ccggttgcag        60
     ggggagattg agctgctgcg ccgggaggca gaagagctgg atactcaagt tgtcgcgcag       120
     cgacagcgct tggagagggc agagaagaac cttcttgcga tcgagacatc tcttggtatg       180
     cacgaagtgc aagtcgacgt tggtgacatt gccgcagtca ttcctcatgt caatcaacct       240
     atttataggc acggtgacct aactcgaaac ttgtatgccg cgctgagaat cgcgggggat       300
     tggctgacaa ccggcgagtt ggttgagcgc ctgacggggc acacttacga gaattgcgac       360
     cgcaagttgt acgagaggat ccggcggtcg tttcggaaac gcctgacctc attggtttcc       420
     aagggaagtg tagagcgaga gttttcccag ggcaccacgg attgccgaca gaatcatacc       480
     cgctggcgtc tgctgtccgg cagacactag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page