(data stored in ACNUC9435 zone)

EMBL: AM039951.PE20

AM039951.PE20        Location/Qualifiers
FT   CDS_pept        complement(23205..23723)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19832"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19832.1"
FT                   /translation="MMTNTQLNRIPSVELQLLTWLRLVKVGGIPNRVDLKRGGFRVQVH
FT                   PAIHNLDGFGRRVDVLNIAQVVANPRYEGRGWFTGFLELCDELNPWDATYVGSVVNPHL
FT                   PAFLRRQGFIEQQGAQFYRPSKAWRVHHSWSVECASSAQADADAARVEGLLDNFELETI
FT                   MVREAMLQR"
     atgatgacca acactcagct caacaggatt ccgagcgtag agcttcagtt gcttacgtgg        60
     ctaagactcg taaaagtggg ggggataccg aaccgtgtgg atctaaaacg aggaggcttc       120
     agagttcagg tgcatccggc catccataat ctagatggat ttggtcggcg cgtcgacgtg       180
     ctcaacattg cgcaagtcgt tgccaatccg cgatatgaag gccgaggctg gttcactggt       240
     ttccttgaac tatgtgatga gctaaacccg tgggatgcga cgtatgtcgg cagtgtcgtg       300
     aatccccact tgcctgcctt tctccgccgg caaggattta tcgagcaaca aggagcgcag       360
     ttctatcgac cttcgaaggc atggagggtt caccacagct ggtcggttga atgcgcatcc       420
     tcggcacagg ccgatgcaga cgccgcacgc gtagaagggc ttctggacaa cttcgagctg       480
     gagacgatta tggtaagaga ggcaatgctg caacgttga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page