(data stored in ACNUC9435 zone)

EMBL: AM039951.PE28

AM039951.PE28        Location/Qualifiers
FT   CDS_pept        35189..35692
FT                   /transl_table=11
FT                   /locus_tag="XCVd0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19840"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19840.1"
FT                   /translation="MAALDLAPPKLVEFWRSYAPELGDLVSVMDRAENWTVDREPLLAD
FT                   RLVALGRRMTGPDQARAFVSADVPDLLLFLAYISTSTALRVIHWLDEQDEYQQYGSTVV
FT                   QRLLDAPGHLAGAIALSPLRDLLALRLRVISNTPYFTKLFAPERLAGLGAAITRYRQEA
FT                   VDVS"
     atggctgcgc tagacctcgc accccccaag ctcgtcgagt tctggcgtag ttatgccccg        60
     gaactggggg acttggtcag cgtcatggat agggccgaga actggactgt ggatcgggag       120
     ccactcttag ccgatcgcct ggtcgcgctc ggccgccgga tgaccgggcc agatcaggcc       180
     cgcgcgttcg tttcggcgga cgtgcctgac ttgctcctat ttcttgccta tatctccacc       240
     agcacagccc tacgcgtcat ccattggttg gacgagcagg atgagtatca gcagtacgga       300
     tccaccgttg tccagcggct gctggacgct ccaggtcact tagccggagc gattgcgttg       360
     tcaccgttac gagaccttct ggcgctacgc ctgcgcgtca tcagcaacac gccgtacttt       420
     actaagctct tcgctccgga gcgccttgcc gggctcgggg cggccattac ccgctaccgc       480
     caggaggctg tcgatgtctc gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page