(data stored in ACNUC9435 zone)

EMBL: AM039951.PE29

AM039951.PE29        Location/Qualifiers
FT   CDS_pept        35682..36182
FT                   /transl_table=11
FT                   /locus_tag="XCVd0029"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19841.1"
FT                   /translation="MSRKIALAPLLGALLLTSGTASAIDAASVQAYCDQVRQSAQQAKQ
FT                   RHVQIFAPRQDPGKTFDDATQSCLDGIMSYKSMFQFKMPSLGDVQGILSQMAKEMLNKQ
FT                   CQAARAQFDRAVQDAVSTVNQSTNQLPGVDVDVSTGSGVTVKPKDGESTIWGSIVNKLG
FT                   GDK"
     atgtctcgta aaattgccct tgcgcccctg ctgggcgcgt tgctactcac tagcgggacc        60
     gcgtcagcaa tcgatgccgc atctgtccaa gcttactgcg accaagttcg acagtccgct       120
     caacaagcga agcagagaca cgtgcagatc tttgctccga gacaggatcc gggtaaaaca       180
     ttcgacgatg ccacccagtc gtgcttggac ggcatcatgt cttacaagtc gatgtttcag       240
     ttcaagatgc cttcgctcgg cgacgtgcag gggatcttga gtcagatggc gaaggagatg       300
     ctgaacaagc agtgtcaggc cgcgcgcgca cagtttgacc gtgcagtcca agacgccgtt       360
     tcaaccgtta accaatccac caatcagttg ccaggcgtag atgtggacgt ctccaccggc       420
     agcggtgtga ctgtcaagcc gaaagacggc gaatctacta tttggggttc gatcgttaac       480
     aagcttggag gcgataaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page