(data stored in ACNUC9435 zone)

EMBL: AM039951.PE30

AM039951.PE30        Location/Qualifiers
FT   CDS_pept        36182..37318
FT                   /transl_table=11
FT                   /locus_tag="XCVd0030"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19842"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19842.1"
FT                   /translation="MLLLRRFTALIFSLLVLGTSTLLIFSASTESTACCGDGVVAAAGA
FT                   EAAGASVVTAVGSATTSIITQLQLMDQNVSSGFGRLYEELAKQTAAQRTFEQGAISAQT
FT                   QMYMEERRAEAEEKYALSPRACFETASGVASTVAAGETKEAVNDLNRLMTDRTLNTPNT
FT                   AAAIGRIYKDHAEKYCSAQDAQLGRCTAVAAELQNADVRADVLLGSASLTPAQSDAAKA
FT                   LVANIVNPIPTQNIPTKWENTAQGRAFVSGQLLEQARTSVAANSLNQAVAARTRIPGLG
FT                   SAAMLNRADVSEREMMEAQVRGRFESPDWYKMLAAMSTENLLRELNKQSAFGLWMDYRE
FT                   FSQMERIESLLATDLAVTVKQDSEKRLQQARSAAAKAR"
     atgctgcttc ttcgccggtt caccgcactt attttttcct tgctggtgct gggtacctcg        60
     acgctgctga ttttctctgc atccacagag tcgacagctt gttgtggtga cggggtggtg       120
     gcagccgccg gcgcagaggc cgcgggtgca tcggttgtaa ctgcggttgg gtcagctacc       180
     accagcatta tcacgcagct gcagttgatg gaccaaaacg tgtccagcgg ctttggacgc       240
     ctgtacgaag agcttgccaa gcaaaccgcg gcgcagcgca cctttgagca aggtgcgatt       300
     tcagcgcaga cccagatgta tatggaagag cgtcgcgccg aggcggagga aaagtacgcg       360
     ctttcgccgc gtgcatgttt cgagaccgca agtggcgttg ccagtacggt tgccgccggc       420
     gagaccaaag aagcagtcaa cgatctgaat cgcttgatga ccgaccgcac gctcaatacg       480
     ccaaacactg ccgccgctat cggcaggatc tacaaggatc acgctgagaa gtactgttcg       540
     gctcaggatg cccagctagg gcgctgcaca gcagtggctg ctgaattaca aaacgccgac       600
     gtgcgggctg acgttttgct gggctctgcg agcctgacgc ccgcgcagtc ggatgctgcg       660
     aaagccctgg tcgcgaacat cgtcaatccg atccccacgc aaaacatccc cacgaaatgg       720
     gagaacacgg cgcagggcag agcatttgtt tcggggcaat tgttggaaca agcacgcacg       780
     tcagtagcgg ccaattcgct caatcaagcc gtcgctgcac gcacgagaat tcctggtctc       840
     gggtcagcag cgatgctaaa tcgggctgac gtgtccgagc gggagatgat ggaagcgcag       900
     gtgcggggca ggtttgagtc gcccgactgg tacaagatgc ttgccgctat gagcacagag       960
     aacctgttgc gggaactgaa caagcagtct gctttcggcc tctggatgga ctacagagag      1020
     ttctctcaga tggagcgtat cgaatctctg ctggcgacag atcttgccgt tacggttaag      1080
     caggacagcg aaaagcggct gcagcaagct cgctcggccg cagccaaggc gcgctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page