(data stored in ACNUC9435 zone)

EMBL: AM039951.PE31

AM039951.PE31        Location/Qualifiers
FT   CDS_pept        37318..38148
FT                   /transl_table=11
FT                   /locus_tag="XCVd0031"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19843"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19843.1"
FT                   /translation="MRPSKAAVIIGISGLLAALPYMKASAAYCCDPWGIPGKTAFAAAG
FT                   TSVVGAITAQVTAVSNYLQLYTSQTWSSGFAKTAEELSKQTAASRTFEQGRLAADTSLY
FT                   MTGVSGAAEEQAQEPALLDQTVTNAVLLSEQFNQQKNNRRRDDAGFAEYMRGDSHEDLV
FT                   SRGREFCDLRGKAAGFCDAIASSTLQNADISYNTISNPGDGQYETLTDAEARAARSFVR
FT                   NVVSATPMASTAGSTPQDEHHEALLLADQAVLSLAAHSLHSVMQNRVRKRENGQ"
     atgaggccct ccaaggctgc cgtcattatc ggcatcagcg gacttcttgc tgctctgcca        60
     tacatgaaag ccagcgcggc gtattgctgt gacccatggg gtatacctgg gaaaacggca       120
     ttcgccgcag ctggaaccag cgtcgttggt gccataaccg cacaggtgac tgctgtatcc       180
     aactacctgc agctctacac gtcgcagacc tggagcagcg gatttgccaa gacagctgag       240
     gaactgagca agcagaccgc ggccagcagg acattcgagc aaggtcgcct tgcagctgac       300
     acgagtttgt atatgacagg cgtgtcaggc gcagcggaag agcaggcgca ggagcctgcg       360
     ttgctcgatc agactgtcac caatgccgtt ctgctctcgg aacagtttaa tcagcagaaa       420
     aacaaccgtc gtcgggacga tgccggcttt gccgaataca tgcgagggga ttcgcacgag       480
     gacctcgttt cgaggggtcg ggaattttgt gacctgcgcg gaaaagctgc cggattctgc       540
     gatgcgatcg cgtcctccac gctacagaac gcggatatct cgtacaacac catcagtaat       600
     ccaggtgatg ggcagtacga aacgctcacg gatgctgaag ctagggccgc gcgttctttc       660
     gtgcgcaatg tcgtctctgc tacaccgatg gcaagtacgg caggttcgac gccccaggat       720
     gagcatcacg aagcgctgct actggcggac caggccgtgt tgtctcttgc tgcacacagt       780
     ctgcacagcg tcatgcaaaa tcgcgttcgt aaaagggaga acgggcaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page