(data stored in ACNUC9435 zone)

EMBL: AM039951.PE32

AM039951.PE32        Location/Qualifiers
FT   CDS_pept        38145..38759
FT                   /transl_table=11
FT                   /locus_tag="XCVd0032"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19844.1"
FT                   /translation="MMIRALAFALLFIVSCGDAAQASAFDMADVIRDSAAKFAATQKVD
FT                   AGSAVKRMDDLLVRDYGARGRIASEHDPRLKSLYTQAARLLMNGNAISGGTLIVIASQE
FT                   SGYSGSKVGPALQAFIGAMLMPADEEDTVLRDFSERANRARSKLGVLRPELQMAAQLRV
FT                   MGAIYHDPIAVDAGVVALNKLSATADEEGAVAGALTAAGAK"
     atgatgattc gagccctggc attcgcactt ttgttcatcg tcagttgcgg tgatgcggcc        60
     caggcaagtg ccttcgatat ggcagacgtc attcgcgact ctgcggccaa attcgcagcc       120
     acacaaaagg tcgatgccgg cagcgcagtc aagcgaatgg acgatctact agtacgtgac       180
     tatggcgctc ggggacgcat agcgagtgag cacgatccgc ggctgaaatc tctgtacacg       240
     caggccgccc gattgctgat gaacggtaac gcaatttctg gaggcacgtt gattgtcatt       300
     gcttcccaag aatctgggta cagcgggagc aaggttggcc cagcactaca ggcatttatt       360
     ggcgcaatgc tgatgcccgc ggacgaggaa gacacggtcc tgcgcgactt tagcgagcga       420
     gccaacagag cgcgatccaa actcggcgtt ttgcgtcccg agctccagat ggcagctcag       480
     ctccgtgtga tgggagcgat ctatcatgat ccgatagcag ttgatgccgg tgttgttgca       540
     ctcaataagc tatcggcaac agcagacgag gagggtgccg ttgcaggcgc gttaactgct       600
     gcgggtgcca agtga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page