(data stored in ACNUC9435 zone)

EMBL: AM039951.PE34

AM039951.PE34        Location/Qualifiers
FT   CDS_pept        39827..41131
FT                   /transl_table=11
FT                   /locus_tag="XCVd0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19846.1"
FT                   /translation="MSKLGALREKAVAEGAAVSSVEEEVPPLPPEAPMDAEFIAGLMAS
FT                   AAGAAGIPDRPPEAFPDVAVAPTVDGAPQGNQAPAGASSPPAGHAVPQGGEPHAVAPSA
FT                   PQAGMDTSDLLHALKGAIERLGPARTQAEVLAAPDAQGAWGEVRGLTAAALALGMASPV
FT                   EQLFRRYGAPGEGLLNAAQLKAPLNMAVAGFKPGAAPLAATQAKAAAAAAGQQAMGGPG
FT                   GGGGGGAGSVGAALAKLVAAPVTIPMAAGSRVWQMMQTRFGPRPKVQPGVDGFSVIRQQ
FT                   FDDAAGRAIDQIAHLRSGPMKSFLTEMAQDPLRPSEQLRRMQGDKKGTYFERAKQLREL
FT                   SAQPEVQGQYKKLNDAMEHLQYRSRRLAEYGHEAGMDVEDIIGDKLESVSKAGEGIPMT
FT                   DGKGKLAELRESLDALIERIREFLRTLFARPGASP"
     atgagcaagc tcggtgcatt gcgtgagaag gctgttgcgg agggggcggc tgtctccagc        60
     gtggaagagg aggtcccgcc cttgccgccc gaagcaccca tggatgccga gtttattgca       120
     ggtctgatgg cgagcgccgc cggtgccgcc ggtattcccg atcgcccgcc cgaagcgttt       180
     ccggacgttg cagtcgcccc cacggtggat ggtgccccgc agggcaacca agcccctgca       240
     ggtgccagca gcccacccgc tgggcacgct gtgccgcagg gcggtgagcc gcatgccgtg       300
     gcccccagcg caccacaggc cgggatggac acgtcggacc tgctgcatgc attgaagggt       360
     gcgatcgagc gtctcggccc agctcgaacc caagcagagg tcctcgccgc tcccgacgcg       420
     caaggtgcat ggggggaggt gcgtggattg accgctgcag cgcttgcttt gggcatggcg       480
     tcgcctgtcg agcagctatt ccggcgctac ggtgcgcctg gggagggact gctgaatgcc       540
     gcgcagctga aggcgccatt gaatatggcg gtggctgggt tcaagccggg ggctgccccg       600
     ctggcggcca ctcaggcgaa agctgcggcc gcagccgccg gtcaacaagc catgggcgga       660
     cctggcggtg gcggtggcgg tggcgcgggc agcgtcggcg cagcgcttgc caagctcgta       720
     gctgcacccg tcaccattcc catggcggcc ggcagccgtg tgtggcagat gatgcagacc       780
     cgcttcgggc cgcggcccaa agtgcagcct ggcgttgacg gcttcagcgt gattcggcag       840
     cagttcgatg acgccgccgg tcgagccatt gatcagatcg cccacctgcg ctcaggcccg       900
     atgaagtctt tcctgaccga gatggcgcag gatccgctgc gtccgtccga gcagctgcgc       960
     cgcatgcaag gtgacaagaa gggcacgtat ttcgagcgag ctaagcagct tcgcgagctt      1020
     tctgcccagc cggaagtgca gggtcaatac aagaagctca acgacgcgat ggagcacctc      1080
     cagtacagga gccgacgcct ggccgaatac gggcacgagg ctggcatgga tgtggaggac      1140
     atcatcggcg acaagctgga atccgtgtcc aaagccggcg agggcattcc gatgaccgac      1200
     ggcaagggca agctggcaga gctgcgcgag tcgctagatg cgctgatcga gcggatccgc      1260
     gagttcttgc gcacgttgtt cgcaaggccc ggcgcgtcac cgtga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page