(data stored in ACNUC9435 zone)

EMBL: AM039951.PE35

AM039951.PE35        Location/Qualifiers
FT   CDS_pept        41128..41364
FT                   /transl_table=11
FT                   /locus_tag="XCVd0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19847.1"
FT                   /translation="MRGSTLADYLGACDRYLSGHEQQFTSPWGLVLLAECAADAGLDLS
FT                   EADVSLDAALEQLAERVGLNRQDDLASLPAPGQ"
     gtgagaggct cgacgttggc cgactacctc ggcgcctgtg accggtactt gtccggtcat        60
     gagcagcagt tcaccagccc gtgggggctg gtgctgcttg ccgaatgcgc agcagatgcg       120
     ggcctcgacc tcagcgaggc ggacgtatcg cttgatgcgg ccttggaaca gctcgccgag       180
     cgagtcggcc tcaatcgtca ggacgacctg gcgtccctgc cagcgccggg gcaatag          237
//

If you have problems or comments...

PBIL Back to PBIL home page