(data stored in ACNUC9435 zone)

EMBL: AM039951.PE37

AM039951.PE37        Location/Qualifiers
FT   CDS_pept        43329..43754
FT                   /transl_table=11
FT                   /locus_tag="XCVd0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19849.1"
FT                   /translation="MRLVNIQSFDAASYREFEGIMLEFAKAQGWEFSFQAQPLPLASVF
FT                   NNATFGPALLVAAQVELSLRKIEVDLGLVVQEDNGAMFGRRVEFDPARSHLLTQMWRLT
FT                   QTAYQVDLLPREQNRIVLDLVPAALEPYEAPALQAGQ"
     atgcgccttg tgaatatcca atcgtttgac gcagcttcat atcgcgagtt cgaggggatc        60
     atgctcgaat tcgccaaggc gcaagggtgg gaattcagct ttcaagcgca gccgcttccg       120
     ctggccagcg tgtttaacaa cgcaaccttc ggtcccgctc tcttggtcgc cgcgcaggta       180
     gagctgtccc tgcgcaagat cgaggttgat ctcggcctgg tagttcaaga agacaacgga       240
     gctatgtttg gccgccgcgt tgagttcgat ccggctcgat ctcacctgct gactcagatg       300
     tggcggctga cccagacggc ttaccaagtc gacctgcttc cgcgggagca aaaccgcata       360
     gtcctggacc tggtgccagc ggcactggag ccatacgaag cccccgcgct gcaggccggt       420
     cagtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page