(data stored in ACNUC9435 zone)

EMBL: AM039951.PE38

AM039951.PE38        Location/Qualifiers
FT   CDS_pept        43756..44811
FT                   /transl_table=11
FT                   /locus_tag="XCVd0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19850.1"
FT                   /translation="MGMIRRLMTASGEDAGSNAASEPIADLSPESMTAEVGRQDVGATT
FT                   NAAPSPQLPLEAEHGEAVIPPAPTPVNAPTGAQLTLSMLRAMGPIFRAALVYPGPTAPA
FT                   VEWAQAIKVMSDVSAQVAGQLALMRTEELDVAWARRELHPAVAVIVGEHWLHTVIKMQR
FT                   VQRVGDIKLNAEDILPGIVAALKASDDCGNPHLATERSAVAELLPAMALLQVNAQAYQA
FT                   LLQSDTVDLDVPDLSVDAYLQAVAAAVVDAVETQDARAKLSGALHGDEFREALLRSATG
FT                   IVVKAGETAVNESLARLHEAIKASAPARWLSEEPLQQGFPLARTVELIEQGINRLAGTA
FT                   VYIASKLGTKR"
     atggggatga ttcgtcgatt gatgacggcc tctggtgagg acgctgggtc gaatgcggcc        60
     tcagagccga tcgcggactt gtctccggaa tcaatgaccg ctgaggtagg tcggcaggac       120
     gtcggagcga ccacaaacgc ggctccctca ccgcagctgc ctcttgaagc agagcatggc       180
     gaggcggtga ttccgccggc gccgacaccg gttaacgcac cgaccggtgc tcagctcacc       240
     ctgtcaatgt tgcgtgcaat ggggcccatc ttccgcgcag cgctggtcta cccagggcca       300
     acggcgccgg cggtggagtg ggcacaagcc atcaaggtca tgtccgacgt gtccgctcag       360
     gtggctggcc aactcgcgct catgcgcacc gaggaactcg acgttgcgtg ggcccgccgg       420
     gagctgcacc ccgccgtcgc tgtgattgta ggcgagcatt ggctacacac tgtgatcaag       480
     atgcaacggg tgcagagagt cggcgacatc aagctcaacg ccgaagacat actgcccggg       540
     atcgtggcag cgctgaaggc ctccgacgac tgtggcaatc cgcacctggc aaccgaacgt       600
     tcagctgttg ccgagcttct gccggcgatg gcgttgctcc aggtcaatgc gcaggcatac       660
     caagcgcttt tgcagtccga cacagtcgat ctcgatgtgc cggatctctc cgtagatgcg       720
     tatctgcaag ctgtcgccgc ggccgttgtc gacgcagttg agacccagga cgccagggca       780
     aagctcagtg gtgctctcca cggtgatgag tttcgggagg ccctcctgag gtctgcaacc       840
     ggcatcgttg tcaaggccgg ggagaccgcg gtgaacgaga gtctggcccg cttgcatgag       900
     gctatcaagg catcggcgcc tgctcgctgg ctcagcgaag agccgctgca gcagggcttc       960
     cccttggccc gcacggttga gttgatcgag cagggcatta accgcctagc ggggacagcg      1020
     gtctatatcg cctccaagct ggggaccaag cgatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page