(data stored in ACNUC9435 zone)

EMBL: AM039951.PE39

AM039951.PE39        Location/Qualifiers
FT   CDS_pept        44808..45305
FT                   /transl_table=11
FT                   /locus_tag="XCVd0039"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19851"
FT                   /db_xref="GOA:Q3C065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19851.1"
FT                   /translation="MTEEVPAKKIQAPRVDVTPAPTRRRAIAGVARLARIVYLGDLGEI
FT                   RRTHAYFRDRLQRVLHQGRYARNETFEEAQARLGLTPQDVARRAAELRSQSLLYLGVAG
FT                   VALFVFLLLPLVSNPISHAVMSLLVMVLALSKYSVSRWRQGQCEERNLVPYMSYWLRWW
FT                   RS"
     atgacagagg aagtcccggc aaagaagatc caggcacctc gggtcgatgt gacgccagcg        60
     ccaacccgac gcagggctat cgccggcgtc gcgcgcctgg cgcgtatcgt ctacttgggg       120
     gatcttggtg agatccggcg aacgcacgcg tacttccgcg atcgtctgca gagggttctg       180
     caccaagggc gctatgcgcg caacgaaacg ttcgaggaag cgcaggcacg gctcggcctc       240
     acgccccagg acgtagcccg acgcgccgct gagctgcgca gtcaaagcct gctgtacctg       300
     ggcgtggccg gggtggcgct gtttgtcttc ctgcttttgc cactggtgag caatccgatc       360
     agccacgcgg tgatgagtct gctggtgatg gtgctggccc tcagcaagta ctccgtaagc       420
     cgctggcgac aggggcaatg cgaagaaaga aatctggtgc cctacatgtc ctactggctg       480
     cgctggtgga ggtcatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page