(data stored in ACNUC9435 zone)

EMBL: AM039951.PE4

AM039951.PE4         Location/Qualifiers
FT   CDS_pept        complement(4890..6344)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19816"
FT                   /db_xref="GOA:Q3C0A0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19816.1"
FT                   /translation="MYLCAAWLPPGSGLAWCYRAQTSPLMGSHPASDGDGSFFVSVRPA
FT                   PRGRQNAPSVVQAAAIRWRLDWRSQERYHAGYFLCGNVGSELIALPPNRVMTTSTRTEE
FT                   TEAQYRRRVEDLRKRVARIRGQNPADLLPMDLVDDLLGRGHGSEQAATDALAAFKRHRK
FT                   QSSAGERKSGVRMQGSAAEAAAAGVISKATFRQYKAALRAVFQADLETAPTRYDTELLS
FT                   AAIERLDSTPQTGYARKGRAGSALKSKSFKASELALVLREVHKGISESRHSWAVGLKTF
FT                   LEANSLVGLRPCEWAEASIRSGDDGMTVMVVRNAKTTNDRGNGSHRTLLLDDLTTQELG
FT                   ALHEMVELVDRVQSGQILDANGKAVSFDELLKHMRDYLRRLTRQIFPATGNRQHWPTLY
FT                   SLRHQVCADAKQSSTGSAESLRFVAALMGHKTDATATLHYGKRRGGSKGLRVRPSSENV
FT                   ATVEHRDPLSKFSPARDAPRRTKPSR"
     atgtatttgt gcgcggcttg gctgccaccc ggctccggtc ttgcttggtg ctatcgggcg        60
     caaacatccc ctcttatggg atcgcatccg gcctcggacg gcgatgggag ctttttcgtt       120
     tccgtgcgcc ctgcccctcg gggccggcag aacgcaccct ccgttgtcca agctgccgcc       180
     attcggtggc gtctcgattg gcgtagccaa gagcgttacc acgcggggta tttcctgtgt       240
     ggtaacgtag ggagcgagtt gattgccctg ccaccgaatc gagttatgac aacgagcacc       300
     cgcaccgagg aaacagaagc ccagtaccgc cgtcgagtcg aggacttgcg taaacgggtg       360
     gccaggattc gtggtcagaa cccggctgat ctgctcccga tggatctggt cgacgaccta       420
     ctgggacggg gacatggcag cgaacaggcg gcaaccgacg cattggccgc ctttaagcgc       480
     catcgaaagc agtcttcagc cggcgaaagg aaaagcggcg tccggatgca gggttctgct       540
     gccgaggcgg ccgctgccgg tgtcatatcc aaagccacct tccgtcagta caaggctgct       600
     ttgcgcgcgg tgtttcaggc tgacctggag acggcgccca cccgatacga caccgaattg       660
     cttagcgccg cgatcgagcg gctcgattcg acgccgcaga ccggatacgc gcgcaaaggg       720
     cgggcgggct ctgctctgaa gtcgaagtcg ttcaaggcat ccgagctcgc cttggtgctg       780
     cgagaagtcc acaaggggat ctccgagagc cgccattcct gggccgttgg cctcaaaacc       840
     tttcttgagg cgaatagcct cgtgggtctg cgaccatgcg agtgggctga ggcatcgatc       900
     cggtccggcg atgacgggat gaccgttatg gtcgtccgca atgccaagac cacaaacgat       960
     cgcggcaacg gaagccatcg cacgctgctt ctggatgatc tgacgacaca agagcttggc      1020
     gcgctacacg agatggttga gctcgtagat cgcgtgcaga gcggtcaaat cctggacgcc      1080
     aatggaaagg cggtcagctt cgacgagctg ttgaagcaca tgagggatta cctacgccgg      1140
     cttacccggc agatcttccc ggcgaccggc aatcggcagc actggccaac gctctattcc      1200
     ttgcgacacc aggtctgtgc cgatgccaag caatcatcta ctggctccgc cgaatccttg      1260
     aggtttgtgg ccgcgttgat gggccacaag acagacgcga cagccacctt gcattacggc      1320
     aagcgtcgtg gagggagcaa gggactccgc gttcggccgt caagcgaaaa cgtggccacc      1380
     gtagaacaca gggatccgct gtcgaagttc agcccagcgc gggacgcgcc ccgacgcacc      1440
     aagccaagcc gctag                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page