(data stored in ACNUC9435 zone)

EMBL: AM039951.PE42

AM039951.PE42        Location/Qualifiers
FT   CDS_pept        47114..47893
FT                   /transl_table=11
FT                   /locus_tag="XCVd0042"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19854"
FT                   /db_xref="GOA:Q3C062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19854.1"
FT                   /translation="MSKWKIKAVKVPASVARFIPVLGRCADWFERKLRRLYSSMRDRIS
FT                   PPVSVLVKKGRVTIAESVRAGGRVHILEVQPNRAHPLSTIQLQANVLQVGPSTILYADA
FT                   GLAALAYAQVRKAVLPATWSAWILRLVGLIAVVLILRLATVALLGSTAGNAAGGSKLEG
FT                   VSAQMAADPGFSPPSPAPQPLPGASELFGAAAPAGSGDLADQIYQQARAAAAKTEHATM
FT                   PPQPSVNVEGLAGFGLEEGGDQAGPGCDPNLAFKVEQ"
     atgtcgaagt ggaagattaa ggctgtcaag gtcccggcgt ccgtcgccag gtttataccg        60
     gtgctcggtc gctgtgcgga ttggttcgag cggaagcttc gccggcttta cagttcgatg       120
     cgcgatcgca tcagtccgcc ggtgtccgtg ttggtcaaaa agggcagggt caccatcgca       180
     gaatcagtcc gtgctggcgg ccgcgttcat attctggagg tccaaccaaa ccgggcgcac       240
     ccgctttcta cgatccagct gcaggccaat gtgctgcagg ttggtccgag cactatcctc       300
     tacgccgacg cagggctggc cgcactggcc tatgctcagg tgcgcaaggc agtcttgccg       360
     gcgacatggt cggcgtggat cctgcgtctc gttggcctaa ttgccgtggt gctcattctg       420
     cgtctggcga cagtggcgct actcggcagc acggcaggga acgcagccgg cggcagcaag       480
     ctcgaagggg tgtccgccca gatggcggcc gatccggggt tctccccgcc atcgccggca       540
     ccgcagcctt tgcccggagc ttccgagctc ttcggcgctg cagcgccggc ggggtcgggc       600
     gatctcgctg atcagatcta ccagcaggcc cgcgctgccg ctgcgaagac cgagcatgcg       660
     acgatgccgc ctcagccgag cgtaaacgtg gaggggttgg ccggattcgg gcttgaagaa       720
     ggtggtgatc aggcagggcc gggatgcgac ccgaatcttg cgttcaaggt ggagcagtaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page