(data stored in ACNUC9435 zone)

EMBL: AM039951.PE44

AM039951.PE44        Location/Qualifiers
FT   CDS_pept        50461..51081
FT                   /transl_table=11
FT                   /locus_tag="XCVd0044"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19856"
FT                   /db_xref="GOA:Q3C060"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19856.1"
FT                   /translation="MSFELTSLRRRNLLRSIASGIAAMGTGAVLSPAFARSGFVMPYGH
FT                   ADAYTSATFWAQPRVLRLHRPASNETVDACYWRDGQLDSAGYIRICRLLRDVQAGQAAT
FT                   IDMRLLNLLRGMQGWVEASYGIRDPYQVNSGYRTQATNKSTEGAARHSLHMKGQAVDGL
FT                   HPGLPLEYTGNLFKAFQGGGVGFYLNSKKFIHADVGSVRQWRG"
     atgagctttg aactgacttc cctccggcgg cgcaatcttc ttaggtcgat cgcaagcggc        60
     atcgctgcga tggggaccgg tgcagtattg tctcccgctt tcgcgcgcag cggctttgtc       120
     atgccgtatg ggcatgcaga tgcctatacc tccgcaacat tctgggccca gccacgggtg       180
     ttgcgtcttc accgacccgc cagcaacgaa acggtggatg cttgctactg gcgcgatggt       240
     cagcttgata gcgctggata catccggatc tgtcgactct tgagagacgt ccaggccggg       300
     caggctgcaa cgatcgacat gcggctgctg aatctgctac gcggtatgca gggttgggtt       360
     gaggcgtcct atggcatccg ggacccctat caagtcaaca gcggatacag aacacaagca       420
     acgaataaga gcacggaggg agctgcgcgg cactctttgc acatgaaggg ccaggccgtt       480
     gatggcctgc atcccggcct accgctcgaa tacacgggga acctcttcaa ggcctttcaa       540
     ggcggcgggg tggggttcta tctaaacagc aagaaattta ttcacgcaga cgtagggagt       600
     gttcggcaat ggcgaggttg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page