(data stored in ACNUC9435 zone)

EMBL: AM039951.PE45

AM039951.PE45        Location/Qualifiers
FT   CDS_pept        51069..51857
FT                   /transl_table=11
FT                   /locus_tag="XCVd0045"
FT                   /product="putative periplasmic thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19857"
FT                   /db_xref="GOA:Q3C059"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19857.1"
FT                   /translation="MARLINAAVGIALLLTSAVVQNAQASEAPKPTLAERHLMASGVKV
FT                   THRFDSVSGLRAIVADNGADKRLFYVTPDGKSLIAGLVFDESGRNVTTEDMGRAGISAS
FT                   GNTTAVTQLQAQKLWQRVQGLKALKDGNRGADIYVFVDPTCQYCHRLMSMVRPYIAAGT
FT                   LQVRWLPVAILSSRSPGLAEAMYKAPNVAQAIQSVSTNMLKPVPESEAIRLQLAQNLLA
FT                   MRDTGQTGVPLVVYRVGQRVVIKSGVPTDAELVALAGGAK"
     atggcgaggt tgatcaatgc agcggtaggt attgcactac tgctgacaag tgcggtagtg        60
     cagaacgccc aagcgtcgga agcgcccaag ccgacgttgg ccgagcgcca tctcatggcg       120
     tccggcgtca aggtgaccca ccgattcgat tctgtatctg ggttgcgcgc gatcgttgct       180
     gacaacggcg cagacaagcg tctgttttac gtcaccccgg atggcaaatc tctgatcgcg       240
     ggactggttt ttgacgaatc agggcgaaac gtcaccacgg aggacatggg gcgtgcgggc       300
     atctcggcca gtggaaacac gactgccgtc acacaattgc aagcacagaa gctttggcag       360
     cgagttcaag gtctgaaagc gctcaaggat ggcaatcgcg gtgccgatat ttacgtcttc       420
     gtcgacccca catgtcagta ttgtcatcga ctcatgagca tggtccgccc gtacattgca       480
     gcaggcacgc tgcaggtacg ttggttgcca gtggccatcc tctcttcgcg cagtccaggc       540
     ctagctgagg cgatgtataa agcacctaat gtggcgcaag caatccagtc cgtctcgacc       600
     aatatgctca agccagtgcc cgagtctgag gccatccgcc tgcaattggc gcagaatttg       660
     ctagcaatgc gtgacaccgg tcaaactggc gttcccctcg tggtttatcg ggtgggccaa       720
     cgagtggtga tcaagtctgg cgtaccgacg gatgcggagc tcgtagctct cgctggcggc       780
     gctaagtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page