(data stored in ACNUC9435 zone)

EMBL: AM039951.PE47

AM039951.PE47        Location/Qualifiers
FT   CDS_pept        52552..53637
FT                   /transl_table=11
FT                   /locus_tag="XCVd0047"
FT                   /product="putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19859"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19859.1"
FT                   /translation="MGLLRTLRGSLAVPTPQAAAPAASSHVSGLSPASRPVYDRAAEGT
FT                   GIFVKHIEDGGCPWQQPQSKPLEWPRNELRGTPYHGFNAIALAMSGYDDPRWCTFDQAA
FT                   AKGWRVRAGEKATSIFMWKVQEKETGTYDDDGEPITRKFPLLCRFKIFNFAQISGPEPH
FT                   QPHQLTDTEARKLAEPIVETVGMTVTESATGPTGYNPERDSLVVRPRVAYPSEKHYCAD
FT                   LMNGVLAVAAREAVIGLALPAEAEMTDHQRAQRDLRVEIARSMLAMRTGLPLSPPAAVK
FT                   DAAILTLLQSDRREVFRAAKDAENIMRYALAFNPEVLPTLEDEHREQMSAAVAEGAPEM
FT                   VFDPSEFQFWPAELQQDRPRP"
     atgggtctcc tgagaaccct tcggggtagc ctagcagtcc ccacgccaca ggccgccgca        60
     ccggcggcct cttcacatgt gtccggcctc agcccagcgt ctcgtccggt atacgatcgg       120
     gccgcggaag gcaccggcat ctttgtaaag cacatcgaag acggtggttg cccatggcag       180
     cagcctcaaa gcaagccact tgagtggcct cggaacgagc tacgtggcac gccttaccac       240
     ggattcaatg cgatcgccct cgctatgagc gggtatgacg atccccggtg gtgcacattt       300
     gaccaagccg ccgcgaaggg ctggcgggta cgcgctggtg aaaaagcgac ctccatcttc       360
     atgtggaagg ttcaggaaaa ggaaaccggc acgtacgacg atgacggtga gccgatcacg       420
     cggaagtttc cgcttttgtg caggttcaag atcttcaact tcgcccagat ttccggcccg       480
     gaaccgcacc agccgcatca gctgactgac accgaagcgc gcaagctggc cgagccaatc       540
     gtggaaaccg ttggcatgac ggtcacagag tcagcaactg ggcctacggg ctacaaccca       600
     gagagggatt cgctggttgt gcgtccacgt gtcgcctatc cgtctgaaaa gcattactgc       660
     gccgatctga tgaacggtgt cctggcagtc gcggcgcgtg aggcagtgat aggccttgct       720
     ttgcctgcag aagcggagat gactgatcac cagcgtgccc agcgcgattt gcgagtggag       780
     atcgcgcgct cgatgctcgc gatgcgcacc ggcttgccgc tgtcgccgcc ggcggcggtc       840
     aaggatgcgg caatactgac gctactgcag agcgacaggc gcgaggtgtt cagagctgca       900
     aaggatgcgg aaaacatcat gcgttacgcc ttggcgttca acccggaggt tctcccgaca       960
     ctggaggacg agcatcgtga gcagatgagc gccgcggtcg ccgaaggtgc cccagaaatg      1020
     gtgttcgacc cgagtgagtt ccagttttgg ccagcagaac tgcagcaaga tcgcccgagg      1080
     ccgtag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page